Pfaff creative 1467 Owner's Manual

Pfaff creative 1467 Manual

Get Pfaff creative 1467 PDF manuals and user guides View all Pfaff creative 1467 manuals
Add to My Manuals
Save this manual to your list of manuals

Pfaff creative 1467 manual content summary:

  • Pfaff creative 1467 | Owner's Manual - Page 1
    I >19 UO!TDflJ}SUI U LcE ©A©D© ®JJVJd
  • Pfaff creative 1467 | Owner's Manual - Page 2
    bulb 31 Changing the needle 27 Changing the sewing foot 30 Checking the bobbin thread tension 8 Checking the needle thread tension 14 Cleaning and oiling 31 Creative computer keyboard 19 D Detachable work support and accessories Drawing up the bobbin thread Dual feed 28, 29 12 16
  • Pfaff creative 1467 | Owner's Manual - Page 3
    , changing needle, threading bobbin, or changing presser foot, etc. 16. Always unplug sewing machine from the electrical outlet when removing covers, lubricating, or when making any other user servicing adjustments mentioned in the instruction manual. winding. SAVE THESE INSTRUCTIONS 17. Hold plug
  • Pfaff creative 1467 | Owner's Manual - Page 4
    4
  • Pfaff creative 1467 | Owner's Manual - Page 5
    Parts of your sewing machine 100 Carrying handle 101 Hinged top cover 102 Hand wheel 103 Stop motion knob 104 Display 105 "Correct/erase" key 106 "Store program" key 107 Master switch 108 Detachable work support with accessory box and compartment 109 Needle plate 110 Sewing foot holder with sewing
  • Pfaff creative 1467 | Owner's Manual - Page 6
    t Electrical connection Lift off the cover. Fold down the carrying handle. Compartment A con tains foot control, power cord, and Instruction Book. Open cover 101. Plug in the machine. 2
  • Pfaff creative 1467 | Owner's Manual - Page 7
    D CD 0 C, 0 -4 -1 CD 0 CD N/ C)30 C) CC, o - :z CD D 0 O :- C) 0 _ CC)Da_. -D cc D= 0 CD C) 0 a 0 C 0 CD 0 0
  • Pfaff creative 1467 | Owner's Manual - Page 8
    Bobbin winding preparations: Reach under the work support and swing it out toward the left. Open free arm cover 1 27. seIatchAandkeouUhe / I 4
  • Pfaff creative 1467 | Owner's Manual - Page 9
    the bobbin on winder 121 and N turn it until pin A engages in slot B. I Disengaging the sewing mechanism: Hold the hand wheel steady and turn knob 103 towards you. Swing the second thread spool holder towards the back. Push a spool of thread and the small unreeling disc C onto the holder.
  • Pfaff creative 1467 | Owner's Manual - Page 10
    around guide lug B. Lead the thread to winder 121 and wind a few turns on the bobbin clockwise. Push the bobbin to the right. Press down the foot When winding from a thread spool with thread slot, the slot must point to the right of the spool holder. I 6 Engaging the sewing mechanism: Hold the
  • Pfaff creative 1467 | Owner's Manual - Page 11
    on master switch. Swing bobbin winder thread guide 136 forward. Raise the sewing foot with the needle ti "up" position. Push the bobbin onto winder 121. Disengage the sewing mechanism. Draw the needle thread under the sewing foot, to the right, and through thread guide 136 (into slot A md around lug
  • Pfaff creative 1467 | Owner's Manual - Page 12
    4 inserting the bobbin: insert bobbin sc that thread unwinds towards the back (A). Draw the thread into slot B and into eye C. 4Checking the bobbin thread tension: With a brief, sharp upward movement of your hand the bobbin must gra dually slip downwards. (Turn screw 0 to the right for stronger
  • Pfaff creative 1467 | Owner's Manual - Page 13
    switch 107. Raise latch A and push the bobbin case onto stud B as far as it will go, making sure cutout C points upwards. \ 4 Placing spool of thread on pin: Pace the small or medium-size unreeling disc D in front of small spools, and the large disc E in front of large spools.
  • Pfaff creative 1467 | Owner's Manual - Page 14
    needle in its top position, raise the sewmg foot. Draw the thread into slot A, to the left past guide C, from below into slot B and takeup lever 134 (see arrows), then back into slot B and into the right thread guide on the needle holder. Place the needle thread behind hook D and hold it there. Pull
  • Pfaff creative 1467 | Owner's Manual - Page 15
    Swing threader in to needle. Place thread into hook E. Swing threader back, release thread at same time and let threader move back up Then pull the thread fully through
  • Pfaff creative 1467 | Owner's Manual - Page 16
    4 4 C) 0 CD CD CD CD 3 0 0 CD CD- CD. PCD ta) I OC N ta-p CD CDCD5 oTa- CDCDCD.m CD ar CD CD CD CD"
  • Pfaff creative 1467 | Owner's Manual - Page 17
    LHI I II I 4 Swing back work support 108. N Switch off master switch 107. Place fabric under sewing foot, J 4 To insert extrathick fabric plies raise lever 118 higher. /17 - \\, \, Switch on master switch. Lower presser bar lifter 118. (Position A" is the darning position.)
  • Pfaff creative 1467 | Owner's Manual - Page 18
    Operating the foot control: The farther you press the pedal down, the faster the machine runs. Needle thread tension 132 A = Setting mark. Important! The following is essential for obtaining good sewing results: 1. The needle must be in order. 2. The needle- and bobbin thread tensions must be
  • Pfaff creative 1467 | Owner's Manual - Page 19
    4 Raise presser bar litter 118. Remove the fabric at the rear. 4 Thread cutter 141: Pull the threads N through in the direcfion of the arrow. 15
  • Pfaff creative 1467 | Owner's Manual - Page 20
    Dual feed It prevents shifting of the material plies during sewing. Before engaging or disengaging the dual feed always raise the sewing foot. 4 To engage: lower top feed 135 until it snaps in place. To disengage: push top feed lightly downwards, pull it towards the rear and let it move upwards.
  • Pfaff creative 1467 | Owner's Manual - Page 21
    Operating keys of the &ectronic system These are described on the foIowing pages. 17
  • Pfaff creative 1467 | Owner's Manual - Page 22
    " key 115 "Reverse" key 116 "Tie-off/buttonhole/single pattern" key N Electronic bobbin thread monitor: Bobbin thread monitor light 112 starts to flash when the bobbin thread is run ning out. It goes out when a full bobbin is inserted and sewing is resumed. Important: Free arm cover 127 must be kept
  • Pfaff creative 1467 | Owner's Manual - Page 23
    " key 124 Balancing-out & pattern length keys 125 Stitch length & pattern length keys and program check for combinations A "Twin-needle' indicator 4 The Creative computer contains an alphabet, numbers from 0 to 9, and 50 programs. The programs are illustrated together with the seam type and the
  • Pfaff creative 1467 | Owner's Manual - Page 24
    i ri iml prog oo o Program seIection When the Creative is switched on, pro gram -00-appears in display 119. Enter the required number in program dis play 119 using program keys 139, The alphabet
  • Pfaff creative 1467 | Owner's Manual - Page 25
    2 t Stitch length and pattern length setting: Key 125 has three functions: 1. Stitch length selection. The stitch length ranges from 0 to 6 mm. A part of the programs has a limited stitch length. 2. Pattern length selection in pro grams 22 to 39. The pattern length range selectable depends on the
  • Pfaff creative 1467 | Owner's Manual - Page 26
    Balancing out or reverse stitch correction Balancing out serves to correct pattern- or program combinations which are sewn with a slight shift owing to influences by the type of material or working method used. The stitch length of the reverse stit- P ' minus settings shorten the reverse
  • Pfaff creative 1467 | Owner's Manual - Page 27
    the figure. The last program is indica ted by at the right of the figure. When the pedal is pressed, the machine switches to the beginning of the combination. Cancelling a program combination: Press "Correct/erase" key 105 (me m -). The
  • Pfaff creative 1467 | Owner's Manual - Page 28
    key 116 must be pressed. The machine then sews a pat tern and ties it off at the beginning and end. Twin-needle sewing: If symbol A is lit the is sewn mirror-inverted. Com binations can be mirrored by pressing key 122 before sewing start. It is also possible to enter a program mirror-inverted in a
  • Pfaff creative 1467 | Owner's Manual - Page 29
    start" key 123. A pat tern or a combination in progress is reset to the start. - ----- - - -=--------- --- L±i LLLLI I prog oo o 49 9 9 Straight-stitch sewing Program 00 is straight stitch with 13 needle positions. Program 02 is the triple straight stitch with stitch lengths of 1.5 to
  • Pfaff creative 1467 | Owner's Manual - Page 30
    sure you unplug the power cord whenever you have to leave the machine or want to clean it, oil it or change mechanical and accessory parts. c) Be sure to use only a 15-watt light bulb in the sewing lamp. d) The drive belt must never be adjusted by anyone but an authori zed Pfaff agent. Some safety
  • Pfaff creative 1467 | Owner's Manual - Page 31
    ( 0Dm a -m - D 0 0 00D D(0 0 -.4
  • Pfaff creative 1467 | Owner's Manual - Page 32
    N 1481 81B PJUMO1 4fl0 T! 6U!MS pu ljoddns NJM 8 JapUfl qO81
  • Pfaff creative 1467 | Owner's Manual - Page 33
    , needles and bobbins in the accessory box. Sewing feet (standard accessories) O Ordinary sewing foot 1 Fancy-stitch foot, for dual feed 2 Fancy-stitch foot, for bottom feed 3 Blindstitch- and overlock foot 4 Zipper- and edge-sewing foot 5 Buttonhole foot 6 Darning foot 7 Hemming foot 8 Edge guide I
  • Pfaff creative 1467 | Owner's Manual - Page 34
    must be raised. Push the sewing foot downwards at the front. The foot snaps out. To change the buttonhole foot, first pull the runner of the foot fully to the front and than swing the work support to the left. Fitting the sewing foot: Lower lifting lever and locate foot so that pins A enter grooves
  • Pfaff creative 1467 | Owner's Manual - Page 35
    the feed dog and the parts in the vicinity of the sewing hook with a soft brush. Clean the bobbin thread monitor as instruc ted on page 113. After 15-20 opera tion hours, only apply a drop of oil in the hook raceway (see illustration). The machine is maintenance-free and must not be oiled otherwise
  • Pfaff creative 1467 | Owner's Manual - Page 36
    goes on and program 00 (straight stitching with the needle in its middle position) appears in the display. If a program is entered during sewing, it will not become effective until the machine has stopped and the foot control is pressed again. Stitch length and stitch width can be changed during
  • Pfaff creative 1467 | Owner's Manual - Page 37
    charge. 4_ Special accessories Part No. Sewing Operation Appliqué foot Binder (remove sewing foot holder) 93-042 941-91 98 053 484-91 For appliqué work For binding edges with tape Cording foot, 5 grooves (twin needle with 1 8-2.5 mm needle gauge) Cording foot, 7 grooves (twin needle
  • Pfaff creative 1467 | Owner's Manual - Page 38
  • Pfaff creative 1467 | Owner's Manual - Page 39
    -stitch, zigzag-stitch and utility-stitch programs as well as buttonhole program There will certainly be questions arising from time to time concerning sewing problems you encoun ter as a Creative fashion designer. Please feel free to contact your nearest PFAFF dealer at any time. He will be glad to
  • Pfaff creative 1467 | Owner's Manual - Page 40
    Sewing instructions Appliqué work Assembly and serging seams Balancing out letters and numbers Basting Binding edges Binding edges with non-woven tape Blind stitch Buttonholes Multi-colour embroidery N Narrow hem with the hemmer foot Narrow pleats Needle chart Needle position left, right 112
  • Pfaff creative 1467 | Owner's Manual - Page 41
    Shirring with shirring foot Shirring with straight stitch Single patterns Smocking with elastic thread Spacing between words Straight stitch Stretch triple straight stitch Stretch triple zigzag stitch T Tailors tacks Tips for embroidering and sewing Top stitch seams 82 Topstitching collar
  • Pfaff creative 1467 | Owner's Manual - Page 42
    programs from 00 to 21 • Embroidery-stitch programs from 22 to 36 and from 40 to 50 • Buttonhole program Lingerie buttonhole (Program 13) Eyelet buttonhole (Program 14) Button sewing program (Program 15) • Cross-stitch program (Program 37) • Hem-stitching programs (Programs 38 and 39) • Alphabet
  • Pfaff creative 1467 | Owner's Manual - Page 43
    - normai sewing foot Machine settings recommended feed disengaged Recommended needle thread tension, e, g. 3- 5 Recommended sewing foot, e. g. 0 Ordinary sewing foot 39
  • Pfaff creative 1467 | Owner's Manual - Page 44
    garments with embroidery motifs made your Pfaff Creative. Transfer the pattern onto the face side of tr fabric with tracing paper. Always place two sheets of tissue paper under t r material before you start sewing. E 04 43 44 46 1-i 3+ j 2 Sewing thread: Embroidery thread Motif 1 is made up of the
  • Pfaff creative 1467 | Owner's Manual - Page 45
    borders You can give free rein to your creativity by combi ning various patterns. The ornamental borders illustrated on this page and described below are intended as a stimulus to your imagination. For sewing ornamental borders we recom mend using the fancy-stitch sewing foot No. 2. • Place tissue
  • Pfaff creative 1467 | Owner's Manual - Page 46
    24 22 43 -3+ 2 First workstep, centre motif • Select program 24 • Needle in down position Sew the programmed stitch pattern, as illusi ted. Shortly before you reach the end of h seam, press the "tieoff/buttonhole" key. At h end of the pattern the needle remains dowr the material. Turn the fabric
  • Pfaff creative 1467 | Owner's Manual - Page 47
    programmed stitch pattern, as illustra ted. Border 2 First workstep, centre motif • Select program 36 Sew the programmed stitch pattern. Second workstep, heart motif • Select program 30 Sew the programmed stitch pattern with the right edge of the sewing foot running along the centre motif. 2 43
  • Pfaff creative 1467 | Owner's Manual - Page 48
    ard the other to the left of disc "C". Continue threa I ing in the usual way, threading each needle sepa rately. See page 56. Border 2 • Begin by sewing the centre motif. • Then sew along the scallops at sewing-foot width. • Finally sew the petal-shaped motifs at the scal lop tips (Fig. 2). 44
  • Pfaff creative 1467 | Owner's Manual - Page 49
    L 74 ...j -. . . 4 . - 7.---: .- 7 1,)4 . -- - -. 3 I I A I Sewing monograms with the embroidery foot r prog Thread: embroidering/darning thread Clear-lined block letters or monograms made by combining different ornamental patterns can be sewn without any difficulty. Trace the
  • Pfaff creative 1467 | Owner's Manual - Page 50
    is no longer requin d cancel it in the MEM-memory by pressing t ii. mem - key (see page 62). • Fancy-stitch foot No. 2 has red marking in which make cross-stitch sewing easier for y u The crosswise lines in the foot indicate the pt tern start. • Let the left metal edge in the window of
  • Pfaff creative 1467 | Owner's Manual - Page 51
    a. ...'. 4 S II i 1 : 51 2 : •.; ...L... .,..:.. IS'. 1 .).k•s ; • 5• 59 .4 5 • in i f:c::'::t.': ta: t !3P:i 4 ;. : r t' h bK:.. & t:. •I. • I I • fl t 1 b :" : . SI • S ri lb I I: Sb ' V j1 '1 Y !1 i % • I Ii lIf •...• .. . • •i I '. • •S I •5 IS S5 •. • a )Ii 4 , ,
  • Pfaff creative 1467 | Owner's Manual - Page 52
    0) co fl\ 42% 7 1t 9i 4 2
  • Pfaff creative 1467 | Owner's Manual - Page 53
    -3+ 2 Ffrst workstep, centre motif Enter the following programs in the computer by pressing the mem + key: • 1x37 • 1 x 37r pattern mirroring • Sew the pattern along the traced line. 56 Second workstep, outside edges Enter the following programs in the computer: • 4 x 37 S • 2 x 37i
  • Pfaff creative 1467 | Owner's Manual - Page 54
    pressing the mem + key: • 1x37 • 3 x 37i pattern mirroring - • Sew the pattern along the traced line. At (I end of the pattern, turn the material the mem+ key: • 2x37 • 2 x 37i pattern mirroring • Sew the pattern along the traced line. Second workstep, outside edges Enter the following
  • Pfaff creative 1467 | Owner's Manual - Page 55
    2.5 mm Follow the pre-traced lines with a program 04 seam. Second worketep, leaves • Program 40 • • Stitch width 5.0 mm Sew the leaf motifs slightly curved, starting at the stem. Third workstep, eyelets • Program ill pattern mirroring •MmiadrFkdolrteheoeyfeptlohesetitefilomonwbreoorfit
  • Pfaff creative 1467 | Owner's Manual - Page 56
    accessory) prog r --' 11 2-3 remov - Key: pattern mirroring Feed dog: lowered Presser bar lifter: in darning position (page 9l Sewing thread: embroidering and darning thread Fitting the eyeletting plate: insert the plate w ti the double catch engaging behind the midh tooth row, place
  • Pfaff creative 1467 | Owner's Manual - Page 57
    • • • q • 3' •4 FgHuoerirdetehaitsrheteytpheeemoibnfrsoetmirdubecrrtyoioidhneosrofyopritesivesewvnielnyrygaitnmhdepsodtrieftaafednritelytno.t motifs: Motif 1: 2 worksteps lstworkstep: program lii mirror pattern stitch width 2.0 mm 2nd workstep: program 44 stitch width 6.0 mm Motif 2: 2
  • Pfaff creative 1467 | Owner's Manual - Page 58
    First workstep (wings) c 1 _L_L_ 2-3 Fnngefrn Stitch width: 1.5 mm Stitch length: 0.5 mm Fringe foot: (special accessory) First workstep (wings) First sew a fringe seam as a trial, using a pk of scrap material. During sewing, try differ 'r stitch lengths until you find the one most s iS able. The
  • Pfaff creative 1467 | Owner's Manual - Page 59
    -- 3 -ringe seam (cut open, Fig. 3) Machine setting same as for first workstep butterfly" (wings). ew fringe seam. ngage normal sewing foot. Then fold the fringes to the left or to the right and ew them on where the fringe loops come out of he fabric, selecting a
  • Pfaff creative 1467 | Owner's Manual - Page 60
    43 D I. F 4.. . tL_: t. ..i a • 4% s,. 4t •1 e a 4 4 q. . a. .i. 'I.. '6
  • Pfaff creative 1467 | Owner's Manual - Page 61
    1 2 Ornamental seams on leather Optional -3+ 0 -- - Thread: embroidering/darning thread Needle: 130/705 H-LR, size 80 Sd(teheoai.nesucigble.ysletvli-ayetfnclaoehdtlnhdeeesse)prdlstiiospthsooaapuinplecdllriloaeaosbalerltwe,hlaiemgbyrhseatscthebnaoreouiwansul-e,swoeanodlnev.
  • Pfaff creative 1467 | Owner's Manual - Page 62
    well suited for valanc flounces and frills or for finishing edges. For t:ri sewing job no threads must be drawn out oft fabric. Sew at sewing-foot width along the tab Ir edge, using the edge of the sewing foot as a gui Then carefully trim the excess material along tie hemstitching with a small
  • Pfaff creative 1467 | Owner's Manual - Page 63
    the lace is cut open at the middle and ironed to the sides. Second workstep prog 10 3+ 0 SSttiittcchh width: length: as required as required Sew over the lace edge on both sides with small, dense zigzagstitches from the face side. Cut off the remaining material on the reverse side (Fig
  • Pfaff creative 1467 | Owner's Manual - Page 64
    t i the two threads. Thread each thread separa through thread guides and the needle eye (. 3b). The thread tension should be adapted to e fabnc type. The tighter the tension, the more minent the cording appears. Fig. 1 shows how 1 cording tongue is engaged. For thin materials, the cording foot with
  • Pfaff creative 1467 | Owner's Manual - Page 65
    Cording sewn with gimp thread - prog w (J - 00 - - 5 +- corthnq toot Needle: Twin needle tLnPhielfrateoctduhelgeehtpnhlereaoetduer.nloeldNl poholtacofthleeg"oiB"mfA"fp"ia.snttAdhhferpteeeaarnsdtstrhytaihntgerfrogreoio-mvinnetps(etoFhrfitrge.ttahh1de)e.
  • Pfaff creative 1467 | Owner's Manual - Page 66
    , the blindstitches draw in the ft edge at regular intervals, thus producing a edge effect. The stronger the needle thread sion, the more the fabric edge is indented (FR Adding a wool thread of a different colour not. reinforces the edge, but also makes an attra contrast trimming. Place the material
  • Pfaff creative 1467 | Owner's Manual - Page 67
    matches the fabric grain. Sew along the outline of to 0.25 mm (for cording) Sew over the raw edges of the appliqué with nar row, dense zigzag (purl) stitches. To make the edge of the appliqué more promi nent, insert a filler cord sew along the edges of the design with
  • Pfaff creative 1467 | Owner's Manual - Page 68
    gauge along the first seam or the traced seam line.' each subsequent seam, guide the gauge fir j' along the preceding line of stitching (Fig. 1). Quilting Preparation of the material is the same as des ni ed above. Just sew around the contours and have a very beautiful piece of embroidery (Fic? During
  • Pfaff creative 1467 | Owner's Manual - Page 69
    4 4 1 >1009 UOITDflJ1SUI II 9 LVE ©zjj©tfi© 4JVJd
  • Pfaff creative 1467 | Owner's Manual - Page 70
    7)
  • Pfaff creative 1467 | Owner's Manual - Page 71
    MEM-rnemory for programs 00 to 50 • The Creative computer has one MEMmerr • 12 programs (from 00 other to form a tern sequence. • When the machine is switched off the grams stored are cancelled. • gramming key 139 (Fig. 2). • The MEM-memory is free if no program n her appears in display 104 (Fig.
  • Pfaff creative 1467 | Owner's Manual - Page 72
    . 2). Single patterns 2 Various stitch patterns, such as monograms, numbers, program combinations, and embroi dery motifs, are very attractive when sewn as single patterns (Fig. 4). The machine sews the stitch pattern program med, ties off the seam and stops automatically. 3 63
  • Pfaff creative 1467 | Owner's Manual - Page 73
    key 124) • Press key mem+ (106). The pattern is now stored with the modified (Fig. 3). \_,,______ Pattern mirroring If you want to sew a pattern mirrorinve (Fig. 2), select the respective program, and p o "pattern mirroring' key 122 and • the rnem+ key 106. 3 The pattern mirroring function is
  • Pfaff creative 1467 | Owner's Manual - Page 74
    ____________ rn prog :)o ] ,, //////////// 1 EEl ELJEE71 prog o 1'l o 4) ,-.. o 62 - Changing the stitch length All programs and program combinations can be varied in length and width, as desired, and entered in the computer memory. Before entering the last decorativetitch
  • Pfaff creative 1467 | Owner's Manual - Page 75
    With your PFAFF Creative you can stitch thread Examp'e: K L A U S • Select -A with the bottom-left (minus) gram key 139 (Fig. 1). • Select the letters _K L _A .U S with the top-right (plus) program key 139. • input them in the memory by pressing 0 mem+ key 106 each time (Fig. 2). • Sew
  • Pfaff creative 1467 | Owner's Manual - Page 76
    miELwj42 prog 0 0 0 fL -.__ prog ()o 0 0 - 2 [IiiicE prog co 0 0 494 7c 0 /)/) 4 Sewing dots Dots can be instance after used in many different ways For abbreviations or between two num bers, etc. EZiZZtTZTL .0 -3 + 2 - li - - Example: • Select 1.5 .0 with the
  • Pfaff creative 1467 | Owner's Manual - Page 77
    or four space symbols to the c puter with mem + key 106 • Then input the next word (Fig. 1) Sewing hyphens/dashes prog -- (CJ -* - -3+ 2 Example:PFAFF-CREATIVE • Press bottom-right (minus) program key 1 until the hyphen appears on the display in I required position (Fig. 4) • Press
  • Pfaff creative 1467 | Owner's Manual - Page 78
    69
  • Pfaff creative 1467 | Owner's Manual - Page 79
    / LHi iiiijjj prog ()o 10 42 Writing texts Start out by marking the beginning of the text on the fabric. After sewing, cut the threads between letters and numbers and in the spacings (Fig. 1). If you want to check the correctness of your text, press key 125+. The individual letters
  • Pfaff creative 1467 | Owner's Manual - Page 80
  • Pfaff creative 1467 | Owner's Manual - Page 81
    .iLIAEEi\1 Balancing out letters and numbers Letters or words shift occasionally, dependin the fabric used. This can be corrected with "balancing" key (Fig. 1). The letter or number last input is correc towards plus or minus with key 124, and the rection entered by pressing the me m + key I The
  • Pfaff creative 1467 | Owner's Manual - Page 82
    the PFAFF creative 1467 • Before you begin, first sew a test seam on a scrap piece of the same material. • Check stitch pattern and tension. • Secure the beginning and end of the seam by pressing the "tie-off/button-hole" key. • When sewing light, soft and stretch materials hold the thread ends
  • Pfaff creative 1467 | Owner's Manual - Page 83
    II lb rim Dua' feed Pfaff offer the only household sewing machine the world with built in dual feed. feed can be combined with several sewh feet. To engage: raise sewing foot, push top fe€ downward until it engages. To disengage: lift sewing foot, press top fe lightly downward, pull it to there. and
  • Pfaff creative 1467 | Owner's Manual - Page 84
    fibres are pulled). Use stitch lengths between 2 and 2.5 mm. Knitted or crocheted materials: sew with light needle thread tension and elastic seams. Machine-embroidery silk: to obtain effective motif embroideries set the needle thread tension lighter, i. e. lower than the buttonhole range. 75
  • Pfaff creative 1467 | Owner's Manual - Page 85
    the material (Fig. 1). Basting prog 01 L- -3+ 0 Feed dog: lowered Sewing thread: normal sewing thread For trying on a garment, we recommend secur the parts previously with basting stitches. Pl the workpiece under the sewing foot. Sew c stitch. After that, pull the material by the requir
  • Pfaff creative 1467 | Owner's Manual - Page 86
    V .4
  • Pfaff creative 1467 | Owner's Manual - Page 87
    LLL Wiii prOg 1o o ///////////II left right EZD ZD EED Change of needle position with straight stitch Through adjustment of the needle (needle tion), certain sewing work can be carried easier. For example, if you wish to stitch at a row margin such as on collars or when inser zippers, you
  • Pfaff creative 1467 | Owner's Manual - Page 88
    ________ __Z r 1 ii i" " prog o a a ? i I///t//i///Jt -_.--" 3 L prog T Change of needle position with zigzag stitch S The needle must always be in the highest posi ton. Right needle position (Fig. 3) e. g. Program: 11 Stitch-width: as required stitch-length: as
  • Pfaff creative 1467 | Owner's Manual - Page 89
    higher fort cult materials or several material plies, It is h easier to place the work under the sewing foot not forget to lower the presser bar lifter, in ot to ensure perfect sewing results. Certain work can be carried out easier wi change of needle position (see pages 78 and Stretch triple
  • Pfaff creative 1467 | Owner's Manual - Page 90
    IS Ca., A ja • -'a' S I,'-. i', , y4.. p A 4 P, t a 0. 4 - 't -4 -S .4 a a- •,, • 'p 46. (4 ,_ a a' •', t K S • et •, .I ' .4 p S 0' S 4. 4' 5 a F F S I so p a - 0 a S a a I I, S • S C - 44 5 'S 5 1 5, 4 ',P'e 454' • 'a • a 4 4 C, p. *4
  • Pfaff creative 1467 | Owner's Manual - Page 91
    thread as bobbin thread ftiL'H Buttonhole thread can also be wound on the boi bin and used as bobbin thread. In this cas' sewing thread should be used in the needle. Fe this sewing job the needle thread tension must b. set relatively high. For topstitching the fabric placed in the machine
  • Pfaff creative 1467 | Owner's Manual - Page 92
    -Ii 4 Top-stitch seams sewn with two needle threads I prog oo -- °L 3-5 0 Stitch length: 6.0 mm Needle: 80 Thread: sewing thread If you cannot find a suitable buttonhole thread, try to use two needle threads together. Place one thread to the right, and the other to the left of disc
  • Pfaff creative 1467 | Owner's Manual - Page 93
    . seam allowance over to one side and press. Then i, stitch on the face side of the fabric, using the edge of sewing foot as a guide (Fig. 1). Double lap seam sewn with the felling foot ZE-- I ( - - 00 3 Jn5 te If two lines of stitching are to appear on the face side the lap-seamed fabric
  • Pfaff creative 1467 | Owner's Manual - Page 94
    taut a little with your hands, because with long stitches the seam will pucker easily (Fig. 1). After sewing, leave about 15 cm of thread hang ing. The next two or three seams can be sewn at about sewing-foot width. Finally take hold of all underthreads and pull them. By this means you determine the
  • Pfaff creative 1467 | Owner's Manual - Page 95
    20r * Cording foot (special accessory) First mark the starting line for the shirred se on the underside of the fabric. Insert the need the seam beginning point and place an ela thread around the needle. Insert the elu thread in the groove of the sewing foot in Lower the sewing foot and sew a numbei
  • Pfaff creative 1467 | Owner's Manual - Page 96
    - Stitch length: 3-4 mm How to engage the shrring foot Insert the shirring foot with its rear pin in groove A" and push the shoe foot: Raise the presser bar lifter. Disengage the foot by pushing its front part down. Press hold the presser bar lifter and remove the sewing up and sewing foot
  • Pfaff creative 1467 | Owner's Manual - Page 97
    F oo Stitch length: 3 to 4 mm Bobbin thread: elastic thread, (wind tension- free on bobbin) Needle thread: sewing thread For sewing with elastic threads we recomm buying an additional bobbin case. Because elastic threads are much thicker thar ordinary bobbin thread, the tension on the bo case
  • Pfaff creative 1467 | Owner's Manual - Page 98
    No. 3) Turn screw 'A" fully to the front. The red mark "B" is then on the right sewing foot side, Allow the edge of the material to be sewn to enter close 2 against the red mark. During sewing, the thread is placed over the wire "C". By this means you will receive a beautiful smooth seam (Fig
  • Pfaff creative 1467 | Owner's Manual - Page 99
    the above-mentioned programs it is poss. to repair elastic tapes, or join them, on underw cation. Forthis work it is recommended to use sewing threads (Figs. 1 + 2). Faggotting stitch for sew a hig elastic seam with hem-stitching effect, Tack o the edges to be sewn and place them under sewing foot
  • Pfaff creative 1467 | Owner's Manual - Page 100
    Sewing and overcasting in one operation Seams which are not ironed open can be sewn together and serged in one workstep. The Pfaff Creative 1467 offers a selection of diffe case of loosely woven materials, insert an elastic thread. By this means, the seam keeps its original shape (Fig. 2). 3 91
  • Pfaff creative 1467 | Owner's Manual - Page 101
    a perfect seam on fashion knitted parts, we recommend to insert a w thread and hold it with a slight tension while I over-stitched (Fig. 1). Overlock stitch with edge-thread effect 09 -- 3-5 3 Stitch length: 3.0 mm Position the raw edges under the sewing foot shown in Fig. 2. Make sure
  • Pfaff creative 1467 | Owner's Manual - Page 102
    close to the edge. Gather the fabric to the waist size using straight stitch. Push the part prepared in this way between the elastic tape and pin it firmly. Stitch it on using straps (outerwear) 2 T:TU 1 L 16 On skirts or trousers sew the strap onto the pre pared edge with elastic stitches. 3 93
  • Pfaff creative 1467 | Owner's Manual - Page 103
    about 2.5 of material. Stitch on the face side at about 2 c width. Cut off the protruding material edge on ft inside along the seam (Fig. 2). For threading instructions see page 56. 94
  • Pfaff creative 1467 | Owner's Manual - Page 104
    . Fig. 1 shows how the fabric is drawn into the hem mer foot scroll with the aid of the stitched-down threads. Fig. 2 shows how the fabric edge is fed into the hemmer foot scroll. Hold the fabric tight as you guide it during sewing. Make sure the fabric con tacts the edge of the right
  • Pfaff creative 1467 | Owner's Manual - Page 105
    -press. Push the folded binding over fabric edge and baste it in place, if required. TI sew it on with straight stitches (Fig. 1). Edge-binding with the binder Sewing foot: Binder (special accessory) Program: 00 Stitch length: 2.5 mm, (Fig. a) or Program: 10 Stitch-width: 2.5 mm Stitch
  • Pfaff creative 1467 | Owner's Manual - Page 106
    foot (Fig, 1 + 2a). Before you start blindstitching, adjust the needle penetration point on the folded fabric edge. To do this, adjust the position of edge guide 8" by turning regulating screw "A" so that the needle catches only one thread in the folded edge when it makes its left stitch. Sew
  • Pfaff creative 1467 | Owner's Manual - Page 107
    foot in h "C" and insert the foot so that it rests against stop. When you do so, guide fork "G" fits aroh the presser bar. Release clamp "E", which ft moves down onto retaining screw "F". Tigh; screw "D". Draw up the bobbin thread. Hold both three until the machine has made a few stitches. F sew
  • Pfaff creative 1467 | Owner's Manual - Page 108
    Feed dog: Presser bar litter: Sewing thread: lowered in darning position (see page 98) embroidery and darning thread, wool Draw the wool thread through the needle hole of the darning foot and into the thread guide (Fig. 1). Place the wool thread under the darning foot. 4' Start at the top left
  • Pfaff creative 1467 | Owner's Manual - Page 109
    elastic stitch prog cc] I -- 16 -- 3-5 () Sew as many elastic-stitch seams over the dw ged spot as edge over-sewn with the select stitch. To make the patch more durable you can sew second seam at sewing-foot width from the fi Afterwards cut away the damaged material on II inside (Fig.
  • Pfaff creative 1467 | Owner's Manual - Page 110
    V n t. a a.. as 'V '4, A a. a S r ., .a% *' '.. %' .4. . 1j Sa a -be tb •Iis I .1 'tk 4. 0' smA 1 ;ts... , a
  • Pfaff creative 1467 | Owner's Manual - Page 111
    foot fully to the front before beginning the buttonhole. Sew the first lengthwise seam at the required length (Fig. 1 a). Press key 1 16 "tie-off/button hole. After that the Pfaff Creative sews the first bar and the reverse seam (Fig. 1 b). Shortly before the end of the reverse seam the machine
  • Pfaff creative 1467 | Owner's Manual - Page 112
    bartack. • Set balance key 124 toward + or - and adjust the second buttonhole seam to the first one (Fig. 3). • Sew last bartack. • This change will be maintained for the follow ing buttonholes. Adaption of buttonhole length A garment may consist of different numbers of fabric plies, e. g. the
  • Pfaff creative 1467 | Owner's Manual - Page 113
    is located later. Pull the gimp threads through to the underside with a needle, secure them and trim them. We recommend to determine the second scanE bar yourself for this type of buttonhole (see page 102). After sewing, cut the buttonholes open (see page 106). Single buttonhole As you know, it is
  • Pfaff creative 1467 | Owner's Manual - Page 114
    Eyelet buttonholes 14 - Sewing thread: Embroidery and darning thread Key: press "sew slow" Eyelet buttonholes are often the required length for the buttonhole with stitch length key 125. The machine sews the selected buttonhole automatically. Adapting buttonhole seams with the balance key
  • Pfaff creative 1467 | Owner's Manual - Page 115
    seam ripper about 1 mm away from the bartack. Now carefully cut the buttonhole open to the middle, then repeat this from the bartack at the made on the fabrk beforehand and push the fabric with the buttor under the sewing foot holder (Fig. 2). Turn th hand wheel towards you and adjust the position
  • Pfaff creative 1467 | Owner's Manual - Page 116
    seam margin. Shortly before the end of the seam, leave the needle down in the material, raise the foot, and open the zipper (Fig. 5). Lower the foot again, and sew the rest of the seam. Our sewing tip: If you lack practice, we recom mend using the quilting gauge to obtain parallel seams. If
  • Pfaff creative 1467 | Owner's Manual - Page 117
    the zipper. The zipper teeth move along the righthand guide edge (Fig. 1). Shortl before you reach the end of the seam, leave the needle down in the material, raise the sewing foo and open the zipper. Then lower the foot agair and sew the seam to the end. Close the zipper. Fold the right
  • Pfaff creative 1467 | Owner's Manual - Page 118
    I 4 :' N 0 CD
  • Pfaff creative 1467 | Owner's Manual - Page 119
    - Medium ball point Heavy ball point Stretch-fabric needle developed especially for Pfaff. Particularly suitable for delicate stretch and knitted fabrics. Wide-meshed corsetry, sheeting and oilcloth, Seams topstitched with buttonhole silk or No. 3013 synthetic thread. 130/705 H-WING 100 _- cJ
  • Pfaff creative 1467 | Owner's Manual - Page 120
    80 2.5mm - 90 2.5mm - 100 3.0 mm - 2.5mm 3.0mm 4.0 mm Suitable for Medium-wide cording Widecording Extrawidecording Extra-wide cording Decorative designs sewn with twin needles Before you start sewing, turn the handwheel fabric properly. In this way, needle breakage and can check to
  • Pfaff creative 1467 | Owner's Manual - Page 121
    new needle. Refer to needle table. Let machine feed the fabric. Only guide the material lightly. When inserting the bobbin case, push it in as far as it will go. Check upper and lower tensions. Use first-class thread only. During bobbin winding, do not hold thread in hand, but pass it through the
  • Pfaff creative 1467 | Owner's Manual - Page 122
    Fuse is defective. Insert new fuse. Important: Before exchanging either sewing foot or needle, switch off master switch 107. Never run a threaded machine unless there is a piece of fabric under the sewing foot. If you have to leave the machine, even for a short while, be sure to switch off the
  • Pfaff creative 1467 | Owner's Manual - Page 123
    - NN r! ,/ '% lJ7 -. No. DescripUon AppHcation Straight stitch For all sewing work requiring '-"-' with 13 needle positions special needle positions. 01 Basting stitch For basting stitch For sewing and serging in one operation. For joining and serging seams with edge thread Zigzag stitch
  • Pfaff creative 1467 | Owner's Manual - Page 124
    sewing purl seams. - 13 Light buttonhole For buttonhole sewing. - I-- -- 1A Eyelet buttonhole For buttonholes in outerwear, costumes, coats, etc. -- Stretch stitch 16 For sewing on buttons. -. For sewing 1 9 Honeycomb stitch For sewing on elastic threads, covering terry-cloth seams and
  • Pfaff creative 1467 | Owner's Manual - Page 125
    ___- Embroidery stitch programs _______ 22 23 24 25 26 27 28 29 30 31 32 33 34 35 ',. 4 ,: .'-, I_I •Jc''/ 77Lr_.'..' ,; 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 9 .% .0 IN IN ', 22-36 40-50 Embroidery stitch programs For fancy seams, ornaments, borders and embroideries. Cross
  • Pfaff creative 1467 | Owner's Manual - Page 126
  • Pfaff creative 1467 | Owner's Manual - Page 127
    FAFF ritznerstra(3e 11 300 Karlsruhe 41 to oIterntons in design. Printed in Wnst Germany Nt 2992499401 engl HR 1192
  • Pfaff creative 1467 | Owner's Manual - Page 128
    IaIITE( h® t ALiL S 1147 Instruction Book C
  • Pfaff creative 1467 | Owner's Manual - Page 129
  • Pfaff creative 1467 | Owner's Manual - Page 130
    ) 4 A
  • Pfaff creative 1467 | Owner's Manual - Page 131
    2 Ornamental seams on leather h 3 ± tnaij -h Thread: embroidering/darning thread Needle: 130/705 H-LR, size 80 Since leather is a pliable material, an underlay of double-folded paper or light non-woven material (e. g. vylene) should always
  • Pfaff creative 1467 | Owner's Manual - Page 132
    Hemstitching with wing needle prog cci ii -- 38 39 -3 + 2 -- Thread: embroidering/darning thread Needle: wing needle For this work, four are left in, then a Oversew the five threads are further four threads left drawn, five threads threads are drawn. in the fabric using program 38 or 39
  • Pfaff creative 1467 | Owner's Manual - Page 133
    L 10 1i -3 + 01 width: SSttiittcchh length: as required as required Sew over the lace edge on both sides with small, dense zigzag-stitches from 2 -- [] 00 j a -- -3+ 0 Stitch length: 3.0 mm Baste and sew the lace onto the face side of the material (Fig. 3). Secure the corners with
  • Pfaff creative 1467 | Owner's Manual - Page 134
    threads. Thread each thread separately through thread guides and the needle eye (Fig. 3b). The thread tension should be adapted to each fabric type. The tighter the tension, the more pro minent the cording appears. Fig. 1 shows how the cording tongue is engaged. For thin materials, the cording foot
  • Pfaff creative 1467 | Owner's Manual - Page 135
    (Fig. 1). Place the roll of gimp thread in front of the machine (see Fig. 2). Place the beginning of the gimp thread together with the needle- and bottom threads back under the cording foot. Move the detachable work sup port up to the machine. Choose a gimp thread of the same colour as the outer
  • Pfaff creative 1467 | Owner's Manual - Page 136
    materials. Fold over the fabric edge once along the line which is to be decorated. During sewing, the blindstitches draw in the fabric edge at regular intervals, thus producing a shelledge effect. The stronger the needle thread ten sion, the more the fabric edge is indented (Fig. 2). Adding a wool
  • Pfaff creative 1467 | Owner's Manual - Page 137
    matches the fabric grain. Sew along the outline of 0.2 to 0.25 mm (for cording) Sew over the raw edges of the appliqué with nar row, dense zigzag (purl) stitches. To make the edge of the appliqué more promi nent, insert a filler cord sew along the edges of the design
  • Pfaff creative 1467 | Owner's Manual - Page 138
    the first seam or the traced seam line. Fo each subsequent seam, guide the gauge finge along the preceding line of stitching (Fig. 1). Quilting materials. Preparation of the material is the same as describ ed above. Just sew around the contours and yot have a very beautiful piece of embroidery (Fig
  • Pfaff creative 1467 | Owner's Manual - Page 139
  • Pfaff creative 1467 | Owner's Manual - Page 140
    MEM-memory for programs 00 to 50 • The Creative computer has one MEM-memory. • 12 programs ( form a pat tern sequence. • When the machine is switched off the pro grams stored are cancelled pro gramming" key 139 (Fig. 2). • The MEM-memory is free if no program num ber appears in display 104 (Fig. 2).
  • Pfaff creative 1467 | Owner's Manual - Page 141
    , such as monograms, numbers, program combinations, and embroi dery motifs, are very attractive when sewn as single patterns (Fig. 4). ' ess Wirq 1 6 t-fLttc ze after i ) . The machine sews the stitch pattern program med, ties off the seam and stops automatically. 3 63
  • Pfaff creative 1467 | Owner's Manual - Page 142
    (with key 124) • Press key mem+ (106). The pattern is now stored with the modified data (Fig. 3). Pattern mirroring If you want to sew a pattern mirror-inverted (Fig. 2), select the respective program, and press • "pattern mirroring" key 122 and • themem+keylO6. 3 The pattern mirroring function is
  • Pfaff creative 1467 | Owner's Manual - Page 143
    I prog ()o • if 106 125 1//Zi/iiII/ZL I hLJL!/'I /1] prog () ? "a 106 1z//1I //Z Changing the stitch length All programs and program combinations can be varied in length and width, as desired, and entered in the computer memory. Before entering the last decorative-stitch pattern program,
  • Pfaff creative 1467 | Owner's Manual - Page 144
    0 4242 :139 ABLD EFGP-IIJKL t1NOPQRS TU V W XYZ ADL1 C 1235679S ,- prog 42 :i: • 0 106 ° 4 Programming letters and numbers With bers They your from PFAFF 0 to 9 Creative and the you can stitch the num etters of the alphabet. can be used to decorate or mark linen goods or outerwear
  • Pfaff creative 1467 | Owner's Manual - Page 145
    L4iIJEJ1fLJJ prog ()e O O I - -. - [Lii 11111 prog i 0 r0 I LTi" 1 i i:i P9 (>o 0 1 Sewing dots Dots can be used in many different ways. For instance after abbreviations or between two num bers, etc. prog -3+ Example: 1.5 • Select .0 with the bottom-
  • Pfaff creative 1467 | Owner's Manual - Page 146
    three or four space symbols to the com puter with mem+ key 106 • Then input the next word (Fig. 1) Sewing hyphens/dashes prog - - a -3+ 2 Example:PFAFF-CREATIVE • Press bottom-right (minus) program key 139 until the hyphen appears on the display in the required position (Fig. 4) • Press
  • Pfaff creative 1467 | Owner's Manual - Page 147
    69 :Z $ -
  • Pfaff creative 1467 | Owner's Manual - Page 148
    marking the beginning of the text on the fabric. After sewing, cut the threads between letters and numbers and in the spacings (Fig. page 63). For the mdi ;iuai notterns rjress key 116 Sie off/buttonhole after sewing start. See page 63. Programming names together with embroidery stitches r prog
  • Pfaff creative 1467 | Owner's Manual - Page 149
  • Pfaff creative 1467 | Owner's Manual - Page 150
    SDREEV Ba'ancing out setters and numbers Letters or words shift occasionally, depending on the fabric used. This can be corrected with the "balancing" key (Fig. 1). The letter or number last input is corrected towards plus or minus with key 124, and the cor rection entered by pressing the mem + key
  • Pfaff creative 1467 | Owner's Manual - Page 151
    with the PFAFF creative 1467 • Before you begin, first sew a test seam on a scrap piece of the same material. • Check stitch pattern and tension. • Secure the beginning and end of the seam by pressing the "tie-off/button-hole" key. • When sewing light, soft and stretch materials hold the thread ends
  • Pfaff creative 1467 | Owner's Manual - Page 152
    U Dual feed Pfaff offer the only household sewing machine in the world with built in dual feed. . The dual feed can be combined with several sewing feet. To engage: raise sewing foot, push top feed downward until it engages. To disengage: lift sewing foot, press top feed lightly downward, pull it to
  • Pfaff creative 1467 | Owner's Manual - Page 153
    fibres are pulled). Use stitch lengths between 2 and 2.5 mm. Knitted or crocheted materials: sew with light needle thread tension and elastic seams. Machine-embroidery silk: to obtain effective motif embroideries set the needle thread tension lighter, i. e. lower than the buttonhole range. 7P3
  • Pfaff creative 1467 | Owner's Manual - Page 154
    Making tailor's tacks Fringe foot, special accessory prog w cc] J 10 -3 + Fonge toot Stitchwidth: 2 mm Needle: Sewing thread: 80 Machine embroidery thread Sasting is a useful method of transferring seam lines First onto mark cuttings. all contours with tailoring chalk on the tSW
  • Pfaff creative 1467 | Owner's Manual - Page 155
    • N4 1)4 S • -.3 -.3
  • Pfaff creative 1467 | Owner's Manual - Page 156
    140 J7/1111711111 - Lmi.ii71 pog o o o 140 /1/1IILIZ//i! Change of needle position with straight stitch Through adjustment of the needle (needle post tion), certain sewing work can be carried out easier. For example, row margin such as if you wish to stitch at a nar on collars or when
  • Pfaff creative 1467 | Owner's Manual - Page 157
    I IIII (i>. 1 prog o 0 140 /1/f- 3 - 1 1i liii iJ prog 0 0 Change of needle position with zigzag stitch • The needle must always be in the highest posi tion. Right needle position (Fig. 3) e. g. Program: 11 Stitch-width: as required Stitch-length: as required Left
  • Pfaff creative 1467 | Owner's Manual - Page 158
    for diffi cult materials or several material plies. It is then easier to place the work under the sewing foot. Do not forget to lower the presser bar lifter, in order to ensure perfect sewing results. Certain work can be carried out easier with a change of needle position (see pages 78 and 79
  • Pfaff creative 1467 | Owner's Manual - Page 159
  • Pfaff creative 1467 | Owner's Manual - Page 160
    00 I1 6-7 0 Buttonhole thread can also be wound on the bob bin and used as bobbin thread. In this case sewing thread should be used in the needle. Fo this sewing job the needle thread tension must bE set relatively high. For topstitching, the fabric i placed in the machine with the reverse side
  • Pfaff creative 1467 | Owner's Manual - Page 161
    prog -- I [J 00 3-5 0 titch length: 6.0 mm Jeedle: 80 hread: sewing thread you cannot find a suitable buttonhole thread, try use two needle threads together, Place one read to the right, and the other to the left of disc but thread both together through the needle ye. See page 56 (Fig
  • Pfaff creative 1467 | Owner's Manual - Page 162
    to one side and press. Then topstitch on the face side of the fabric, using the edge of the sewing foot as a guide (Fig. 1). Double lap seam sewn with the felling foot prog (1 I.11 00 3-5 Felling foot If two lines of stitching are to appear on the face side of the iapseamed fabric, the two
  • Pfaff creative 1467 | Owner's Manual - Page 163
    taut a little with your hands, because with long stitches the seam will pucker easily (Fig. 1). After sewing, leave about 15 cm of thread hang ing. The next two or three seams can be sewn at about sewing-foot width. Finally take hold of all underthreads and pull them. By this means you determine the
  • Pfaff creative 1467 | Owner's Manual - Page 164
    * Cording foot (special accessory) First mark the starting line for the shirred seams on the underside of the fabric. Insert the needle at the seam beginning point and place an elastic thread around the needle. Insert the elastic thread in the groove of the sewing foot in use. Lower the sewing foot
  • Pfaff creative 1467 | Owner's Manual - Page 165
    It 4 U 7 L t 1 IA TiIh® 1147 Instruction Book 0
  • Pfaff creative 1467 | Owner's Manual - Page 166
    and the smooth outer fabric in the foot cutout (Fig. 1). Lightly stretch the 2 outer fabric during sewing; by this means you determine the degree of gathering. How to disengage the foot: Raise the presser bar lifter, Disengage the sewing foot by pushing its front part down. Press up and hold the
  • Pfaff creative 1467 | Owner's Manual - Page 167
    Stitch length: 3 to 4 mm Bobbin thread: elastic thread, (wind tension- free on bobbin) Needle thread: sewing thread For sewing with elastic threads we recommend buying an additional bobbin case. Because elastic threads are much thicker than an ordinary bobbin thread, the tension on the bobbin case
  • Pfaff creative 1467 | Owner's Manual - Page 168
    No. 3) Turn screw 'A" fully to the front. The red mark "B" is then on the right sewing foot side. Allow the edge of the material to be sewn to enter close 2 against the red mark. During sewing, the thread is placed over the wire "C". By this means you will receive a beautiful smooth seam (Fig
  • Pfaff creative 1467 | Owner's Manual - Page 169
    Ii: C') (p - th Q- C cQ) CD g'- z CD 5 CD :3DC-)D) CD "Dy -'D 3 CD -D_D D3D CD (0 cC- CD 0 CD -4, Dc CD -' _+ s:;: C)D -4. fL1 CD 3D - CD ) CD • coc-.o.) -., 3 CD o Q' th -3 -- oo 0101 - -'CD D DC,) CD 3.DCD CD aD - CDD C-) co 0 D'CD CD 3 a- 0 C-D CoD cE C)
  • Pfaff creative 1467 | Owner's Manual - Page 170
    Sewing and overcasting in one operation Seams which are not ironed open can be sewn together and serged in one workstep. The Pfaff Creative 1467 offers a selection of diffe rent case of loosely woven materials, insert an elastic thread. By this means, the seam keeps its original shape (Fig. 2). 2 3
  • Pfaff creative 1467 | Owner's Manual - Page 171
    seam on fashion-cut knitted parts, we recommend to insert a wool thread and hold it with a slight tension while it is over-stitched (Fig. 1). Overlock stitch with edge-thread effect L prog 09 -- I 3 Stitch length: 3.0 mm Position the raw edges under the sewing foot as shown in Fig. 2. Make
  • Pfaff creative 1467 | Owner's Manual - Page 172
    close to the edge. Gather the fabric to the waist size using straight stitch. Push the part prepared in this way between the elastic tape and pin it firmly. Stitch it on using (outerwear) 2 prog -- 16 3-S 0 On skirts or trousers sew the strap onto the pre pared edge with elastic stitches.
  • Pfaff creative 1467 | Owner's Manual - Page 173
    of material, Stitch on the face side at about 2cm width. Cut off the protruding material edge on the inside along the seam (Fig. 2). For threading instructions see page 56. 2
  • Pfaff creative 1467 | Owner's Manual - Page 174
    . Fig. 1 shows how the fabric is drawn into the hem mer foot scroll with the aid of the stitched-down threads. Fig. 2 shows how the fabric edge is fed into the hemmer foot scroll. Hold the fabric tight as you guide it during sewing. Make sure the fabric con tacts the edge of the right
  • Pfaff creative 1467 | Owner's Manual - Page 175
    Binder (special accessory) Program: Stitch length: 00 2.5 mm, (Fig. a) or Program: 10 Stitch-width: 2.5 mm Stitch length: 1.5 mm, (Fig. b) Remove sewing foot and screw on binder. Insert the bias tape in the scroll of the binder and pull it out to the rear. Set the binder in
  • Pfaff creative 1467 | Owner's Manual - Page 176
    blindstitch foot and sew, making sure the folded fabric edge runs along edge guide guide "B" by turning regulating screw 'A' so that the needle catches only one thread in the folded edge when it makes its left stitch. Sew sew the hem (Fig. 2b). • Follow the instructions given above, 2 / 2a 2b n7
  • Pfaff creative 1467 | Owner's Manual - Page 177
    insert the foot so that it rests against its stop. When you do so, guide fork "G" fits around the presser bar. Release clamp "E", which then moves down onto retaining screw "F". Tighten screw 'D" Draw up the bobbin thread. Hold both threads until the machine has made a few stitches. First sew a few
  • Pfaff creative 1467 | Owner's Manual - Page 178
    : lowered Presser bar lifter: in darning position Sewing thread: (see page 98) embroidery and darning thread, wool Draw the wool thread through the needle hole of the darning foot and into the thread guide (Fig. 1). Place the wool thread under the darning foot. Start at the top left and place
  • Pfaff creative 1467 | Owner's Manual - Page 179
    the face side and the fabric edge over-sewn with the selected stitch. To make the patch more durable you can sew a second seam at sewing-foot width from the first. Afterwards cut away the damaged material on the inside (Fig. 2). Darning torn fabrics H 161pro9g I - - 3-5 0 For mending tears
  • Pfaff creative 1467 | Owner's Manual - Page 180
    - 0 -'
  • Pfaff creative 1467 | Owner's Manual - Page 181
    foot fully to the front before beginning the buttonhole. Sew the first lengthwise seam at the required length (Fig. la). Press key 116 "tie-off/button hole. After that the Pfaff Creative sews the first bar and the reverse seam (Fig. 1 b). Shortly before the end of the reverse seam the machine
  • Pfaff creative 1467 | Owner's Manual - Page 182
    first bartack. I Set balance key 124 toward + or - and adjust the second buttonhole seam to the first one (Fig. 3). I Sew last bartack. • This change will be maintained for the follow ing buttonholes. Adaption of buttonhole length garment may consist of different numbers of abric plies, e. g. the
  • Pfaff creative 1467 | Owner's Manual - Page 183
    later. Pull the gimp threads through to the underside with a needle, secure them and trim them. We recommend to determine the second scans bar yourself for this type of buttonhole (see page 102). Single buttonhole As you know, it is difficult to sew buttonholes in collar stands, waistband strips
  • Pfaff creative 1467 | Owner's Manual - Page 184
    Eyelet buttonholes prog -- 14 -- -3+ Sewing thread: Embroidery and darning thread Key: press "sew slow" Eyelet buttonholes are required length for the buttonhole with stitch length key 125. The machine sews the selected buttonhole automatically. Adapting buttonhole seams with the balance
  • Pfaff creative 1467 | Owner's Manual - Page 185
    tack. Insert the point of the ripper in the middle of the buttonhole seam and cut open one half carefully, then cut open the other mark made on the fabric beforehand and push the fabric with the button under the sewing foot holder (Fig. 2). Turn the hand wheel towards you and adjust the position of
  • Pfaff creative 1467 | Owner's Manual - Page 186
    seam margin. Shortly before the end of the seam, leave the needle down in the material, raise the foot, and open the zipper (Fig. 5). Lower the foot again, and sew the rest of the seam. Our sewing tip: If you lack practice, we recom mend using the quilting gauge to obtain parallel seams. If
  • Pfaff creative 1467 | Owner's Manual - Page 187
    the zipper. The zipper teeth move along the right-hand guide edge (Fig. 1). Shortly before you reach the end of the seam, leave the needle down in the material, raise the sewing foot and open the zipper. Then lower the foot again and sew the seam to the end. Close the zipper. Fold the right
  • Pfaff creative 1467 | Owner's Manual - Page 188
    6W
  • Pfaff creative 1467 | Owner's Manual - Page 189
    110 Medium -zE ball point Heavy ball point Stretch-fabric needle developed especially for Pfaff. Particularly suitable for delicate stretch and knitted fabrics. Wide-meshed corsetry, Lycra, point, Seams topstitched with buttonhole silk long eye or No. 30/3 synthetic thread. 130/705 H-WING 100
  • Pfaff creative 1467 | Owner's Manual - Page 190
    Stitch width - - - - Needle spacing 1.6mm 2.0 mm 2.5 mm 3.0 mm 4.0 mm Suitable for Medium-wide cording Wide cording Extra wide cording Extrawide cording Decorative designs sewn with twin needles Before you start sewing, turn the handwheel and check to make sure the needles stitch into the fabric
  • Pfaff creative 1467 | Owner's Manual - Page 191
    new needle. Refer to needle table. Let machine feed the fabric. Only guide the material lightly. When inserting the bobbin case, push it in as far as it will go. Check upper and lower tensions. Use first-class thread only. During bobbin winding, do not hold thread in hand, but pass it through the
  • Pfaff creative 1467 | Owner's Manual - Page 192
    Fuse is defective. Insert new fuse. Important: Before exchanging either sewing foot or needle, switch off master switch 107. Never run a threaded machine unless there is a piece of fabric under the sewing foot. If you have to leave the machine, even for a short while, be sure to switch off the
  • 1
  • 2
  • 3
  • 4
  • 5
  • 6
  • 7
  • 8
  • 9
  • 10
  • 11
  • 12
  • 13
  • 14
  • 15
  • 16
  • 17
  • 18
  • 19
  • 20
  • 21
  • 22
  • 23
  • 24
  • 25
  • 26
  • 27
  • 28
  • 29
  • 30
  • 31
  • 32
  • 33
  • 34
  • 35
  • 36
  • 37
  • 38
  • 39
  • 40
  • 41
  • 42
  • 43
  • 44
  • 45
  • 46
  • 47
  • 48
  • 49
  • 50
  • 51
  • 52
  • 53
  • 54
  • 55
  • 56
  • 57
  • 58
  • 59
  • 60
  • 61
  • 62
  • 63
  • 64
  • 65
  • 66
  • 67
  • 68
  • 69
  • 70
  • 71
  • 72
  • 73
  • 74
  • 75
  • 76
  • 77
  • 78
  • 79
  • 80
  • 81
  • 82
  • 83
  • 84
  • 85
  • 86
  • 87
  • 88
  • 89
  • 90
  • 91
  • 92
  • 93
  • 94
  • 95
  • 96
  • 97
  • 98
  • 99
  • 100
  • 101
  • 102
  • 103
  • 104
  • 105
  • 106
  • 107
  • 108
  • 109
  • 110
  • 111
  • 112
  • 113
  • 114
  • 115
  • 116
  • 117
  • 118
  • 119
  • 120
  • 121
  • 122
  • 123
  • 124
  • 125
  • 126
  • 127
  • 128
  • 129
  • 130
  • 131
  • 132
  • 133
  • 134
  • 135
  • 136
  • 137
  • 138
  • 139
  • 140
  • 141
  • 142
  • 143
  • 144
  • 145
  • 146
  • 147
  • 148
  • 149
  • 150
  • 151
  • 152
  • 153
  • 154
  • 155
  • 156
  • 157
  • 158
  • 159
  • 160
  • 161
  • 162
  • 163
  • 164
  • 165
  • 166
  • 167
  • 168
  • 169
  • 170
  • 171
  • 172
  • 173
  • 174
  • 175
  • 176
  • 177
  • 178
  • 179
  • 180
  • 181
  • 182
  • 183
  • 184
  • 185
  • 186
  • 187
  • 188
  • 189
  • 190
  • 191
  • 192
I
>19
UO!TDflJ}SUI
U
LcE
©A©D©
®JJVJd