Singer SE340 LEGACY Instruction Manual and Troubleshooting Guide
Singer SE340 LEGACY Manual
View all Singer SE340 LEGACY manuals
Add to My Manuals
Save this manual to your list of manuals |
Singer SE340 LEGACY manual content summary:
- Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 1
INSTRUCTION MANUAL SE300 SE340 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 2
be left unattended when plugged in. Always unplug this sewing machine from the electric outlet immediately after using and before cleaning, removing covers or when making any other user servicing adjustments mentioned in the instruction manual. WARNING 7RUHGXFHWKHULVNRIEXUQV¿UHHOHFWULF - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 3
from light to heavy material and sewing embroidery designs and lettering. Please refer to this booklet for proper use and optimum performance. To get the most out of your sewing machine, read the entire instruction manual before attempting to operate the machine. Then familiarize yourself with the - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 4
17 18 ,16(57,1*7+(%2%%,1 18 THREADING THE NEEDLE 19 PREPARING TO THREAD MACHINE 19 6(77,1*6322/2)7+5($'216322/3,1 19 THREADING THE UPPER THREAD 19 7+5($',1*7+(1 20 DRAWING UP THE BOBBIN THREAD 20 SEWING STARTING TO SEW 21 :+(5(7286(($&+67,7 21 67$57,1*726 22 67$57 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 5
+223237,21$1'6(/(&7,21 50 TRACING 51 %$67,1 51 MONOCHROME 51 EMBROIDER A DESIGN 52 67,7&+2876&5((1 52 67$57726 52 EMBROIDERY LETTERS 53 6(/(&7,1*(0%52,'(5 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 6
3UHVVHU)RRW )HHG'RJV 1HHGOH&ODPS6FUHZ 32. Needle Thread Guide 33. Needle 34. Needle Plate 35. Bobbin Cover 36. Bobbin Embroidery Unit Release Lever /HYHO$GMXVWLQJ)HHW %RWWRPRI8QLW 49 50 51 52 52. Embroidery Hoop Carriage 53. Embroidery Hoop Connection Assembly 54. Embroidery - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 7
SETTING UP THE MACHINE ACCESSORIES 6RPHDFFHVVRULHVDUHVWRUHGLQWKHDFFHVVRU\WUD\ 1. Needle Pack 6,1*(5&ODVV% 13 14 15 16 17 ACCESSORY TRAY OF THE EMBROIDERY UNIT The accessory tray is located on the left side of the embroidery 18 19 20 21 unit. Pull to open. 22 23 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 8
presser foot screw securely using the screwdriver. 5. Lower the presser foot lifting lever and the presser foot will snap into place. NOTE: This sewing machine is a low shank model. When VKRSSLQJIRURSWLRQDO6,1*(5SUHVVHUIHHWDQGDFFHVVRULHV make sure they are designed for low shank models. 8 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 9
or 2020 Medium Weight - gingham, All-purpose SLTXHOLQHQ SRO\HVWHU¿QH cotton, satin, cotton, machine thin corduroy, TXLOWLQJ velvet 6,1*(5 6W\OH 11/80-14/90 or 2020 3. Remove the needle. RQDSSURSULDWHIDEULFVVWDELOL]HUVQHHGOHVDQG threads for embroidery, see page 45. 9 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 10
on the power switch. 5. A lamp will light up when switch is turned on. 6. The harder you press the foot controller, the faster the machine will sew. The machine will stop when foot controller is released. 7KHODPSVZLOOOLJKWXSZKHQVZLWFKLVWXUQHGRQV\PERO, 7RGLVFRQQHFWWXUQWKH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 11
FUNCTIONS TACK BUTTON WITH LED (A) Press the tack button while sewing and your machine sews a few Tack stitches and stops automatically. When pressed while not sewing, machine will sew a tack and stop automatically at the beginning of next sewing. The LED light will turn on until tack stitch has - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 12
ZLOOUDLVHRUORZHU - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 13
of the top cover. NOTE: It is not possible to sew when the embroidery unit is attached. STITCH INFORMATION D 6WLWFK3DWWHUQ The shape of WKLV instruction manual. G 6WLWFK:LGWK1HHGOH3RVLWLRQ H 6WLWFK/HQJWK'HQVLW\ bc HOME SCREEN (A) When you turn on the power, machine will display - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 14
, the numbers will be highlighted. When trying to exceed minimum or maximum settings, a warning sound will be heard. MACHINE SETTINGS SETTING BUTTON (A) Before or during the sewing process, you can adjust the VHWWLQJVE\SUHVVLQJWKH6HWWLQJ%XWWRQ 7KH6HWWLQJ6FUHHQZLOODSSHDU This screen is - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 15
SETTING UP THE MACHINE SEWING PREPARATION 8SSHU7KUHDG7HQVLRQ7RR/RRVH Upper thread will appear thread should appear slightly on the bottom side of your fabric, for example, when doing decorative sewing. In sewing mode, the Twin Needle icon will be shown. The setting is kept until you deactivate - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 16
SEWING PREPARATION AUDIBLE BEEP - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 17
and remove the bobbin cover. 2. Lift up the bobbin from the machine. WINDING THE BOBBIN 1. Hold thread in both hands and hook thread to the guide from front opening. 2. Bring thread to the right and pass it through the thread guide from the back side. Pass thread under the bobbin winding tension - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 18
pin. 3. Bring thread to the right and hook the thread to the thread guide from rear opening. )ROORZWKHQRUPDOZLQGLQJSURFHGXUHIURP6WHSVWRRQ of bobbin cover down until it clicks into place. NOTE: This machine can start to sew without drawing up the bobbin thread. If you want to draw up - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 19
very important to raise the presser foot lifter before you thread the machine. Not doing so will likely result in poor VWLWFKTXDOLW\RUH[FHVVLYH thread through thread guide from right side opening. 8. Pass through needle eye from front to back. Refer to next page for instructions on how to use - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 20
DRAWING UP THE BOBBIN THREAD This machine can start to sew without drawing up the bobbin thread. If you want to start sewing with longer bobbin thread, draw hook pin will go through the needle eye. 5. Draw the thread into the guide, making sure it is under the hook pin. 4. Pull upper thread lightly. - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 21
8.Elastic blind hem 9.Honeycomb stitch %DVLF 6WUDLJKWVWLWFKOHIWQHHGOHSRVLWLRQ )RUWRSVWLWFKLQJIRUEDVLFVHZLQJHWF 11.Button sewing 6WUDLJKWVWLWFKZLWKDXWRUHYHUVHVWLWFKFHQWHU needle position 6WUDLJKWVWLWFKZLWKDXWRUHYHUVHVWLWFKOHIWQHHGOH position 14. Basting - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 22
6HQVRU If upper thread is breaking, machine will stop automatically. Rethread the upper thread and resume sewing. CAUTION 'RQRWSUHVVWKH7KUHDG the foot controller pedal. Keep holding thread after sewing a few stitches. Lightly guide the fabric while sewing. - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 23
be turned on. 6WDUWWRVHZ Machine will sew tacking stitches and stop automatically. SEWING HEAVY FABRIC When sewing heavy or thick fabrics, the toe end sewing. SEWING OVER OVERLAPPED AREAS Guide the fabric with your hand when sewing over overlapped areas. WIDTH OF SEAM ALLOWANCE Guide lines - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 24
1. Position the fabric under the presser foot and lower it. 2. Hold the upper thread loosely and start sewing. Machine will sew 4-5 stitches forward and sew 4-5 stitches backward and continue sewing forward. SATIN STITCHING 7RVHZDVDWLQVWLWFKVKRUWHQWKHVWLWFKOHQJWKDQGDWWDFKWKH6DWLQ )RRW - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 25
non-stretch fabric No. 8 Blind hem for stretch fabric %OLQG+HP)RRW' 4. Lower the presser foot and sew hem, guiding fabric evenly along the guide. 5. Turn the fabric over when you have completed sewing. c. Wrong side of fabric h. Right side of fabric NOTE: Test on a scrap piece of fabric similar - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 26
. Try mixing several types of fabrics for even more variety. No. 0 $OO3XUSRVHRU6DWLQ)RRW$% 1. Place two pieces of fabric right sides together and sew a long straight stitch. 2. Press the seam open. Place fabric so that the needle falls near the edge of the fabric ZKHQXVLQJWKH$OO3XUSRVH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 27
the presser foot and then lower the presser foot lifter. 2. Hold the upper thread loosely and start to sew. Machine will make two stitches only. MULTI-STITCH ZIGZAG Used for sewing on elastic and overcast stitching. 1R0XOWL6WLWFK=LJ]DJ $OO3XUSRVH)RRW$ 3. Raise the presser foot lifter - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 28
or crisscross. THREAD SHANK Buttons on coats and jackets often have a thread shank to make them stand away from the fabric. Insert a straight pin or sewing machine needle under the center slit of the foot from WKHIURQW6HZRYHUWKHSLQRUQHHGOH7RFUHDWHDWKUHDGVKDQN pull thread to the - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 29
HQWHU1HHGOH3RVLWLRQ =LSSHU)RRW( 6WLWFKDFURVVWKHORZHUHQGDQGULJKWVLGHRI]LSSHU Remove the basting and press. 7-10 mm SEWING CAUTION 7RSUHYHQWDFFLGHQWVGRQRWFKDQJHWKHQHHGOH SRVLWLRQ&KDQJLQJQHHGOHSRVLWLRQFRXOGFDXVHWKH QHHGOHKLWWKHSUHVVHUIRRWZKLFKFRXOGEUHDN - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 30
as desired. HAND LOOK QUILTING STITCH (NO. 198) Use invisible nylon sewing thread or very lightweight thread that matches the fabric on top. Place thread WKHEREELQ6HWWKHXSSHUWHQVLRQWR maximum or near maximum. When you sew, bobbin thread will pull to the top and give the appearance of a - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 31
Buttonhole Lever is not lowered properly or buttonhole foot is not positioned correctly. 5. Hold upper thread lightly and start the machine. 6. Machine will sew bar-tack or darning stitch, as shown. 0DFKLQHZLOOVWRSDXWRPDWLFDOO\ZKHQWKHSDWWHUQLV¿QLVKHG $GMXVWVOLGHRQEDVHRI%XWWRQKROH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 32
stretch fabrics, it is suggested that you use interfacing on the backside of the fabric. 5. Lower the Buttonhole Lever completely. NOTE: Machine will not start to sew if Buttonhole Lever is not ORZHUHGSURSHUO\RUIUDPHRI%XWWRQKROH)RRWLVQRW positioned all the way forward. 6. Hold upper thread - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 33
Press the Thread Cutter button and raise the presser foot to remove the fabric. To sew over same buttonhole, raise presser foot to return to original position. 9. Use a seam DQGVHZEXWWRQKROH6HH SUHYLRXVSDJH Machine will sew the buttonhole in the order as shown and stop automatically after - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 34
Press the patch. c. Wrong side of fabric d. Right side of patch 7. Turn the patch and press the side seam allowance. NOTE: When sewing lighter weight fabric, reinforce buttonhole area. &XWDSDWFKRIIXVLEOHLQWHUIDFLQJFP´ ZLGHUDQGFP ´ ORQJHUWKDQWKHEXWWRQKROH)XVHWRZURQJ - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 35
and raise the presser foot. 3. Make a hole in the center of the eyelet. NOTE: Eyelet punch is not provided with this machine. SEWING LIGHTWEIGHT FABRICS When sewing lightweight fabrics, it is suggested that you use stabilizer on the backside of the fabric. This can help prevent stitches from - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 36
RRW CAUTION 7RSUHYHQWDFFLGHQWVGRQRWFKDQJHWKHVWLWFKZLGWKWR ZLGHUWKDQ2WKHUZLVHQHHGOHFRXOGKLWWKHSUHVVHU IRRWDQGEUHDN FREE ARM SEWING By simply removing the extension table, you can access the free arm, making it easier to stitch hard-to-reach areas like SDQWKHPVVOHHYH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 37
help you determine the best settings for the stitch you are sewing. All patterns except No. 11, 16-31 may be sewn NOTE: A twin needle is not provided with this machine. CAUTION 7RSUHYHQWDFFLGHQWV D8VHRQO\6,1*(5EUDQGHG guide. 9. Thread right needle eye by hand from front to back. 37 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 38
SEQUENCE SEWING - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 39
DELETING PATTERN OR LETTER 6KLIWWKHFXUVRUWRWKHSDWWHUQRUOHWWHU\RXZDQWWRGHOHWH 3UHVVWKH'HOHWHEXWWRQG TXLFNO\OHVVWKDQVHF Machine will delete the pattern or letter and cursor will VKLIWWRQH[WSDWWHUQRUOHWWHU,ILWZDVODVWSDWWHUQRUOHWWHU cursor will shift - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 40
LQWRPHPRU\7KHUHDUH IRXUVHSDUDWHPHPRU\IROGHUVIRUVDYLQJVWLWFKVHTXHQFHV 0HPRUL]HGVHTXHQFHVUHPDLQLQWKHPHPRU\LI\RXWXUQRIIWKH machine. :KHQWKHVHOHFWHG¿OHQXPEHULVKLJKOLJKWHGSUHVVWKH³✓´ button. 5HFDOOHGVHTXHQFHLVVKRZQRQWKHOHIWVLGHRI/&' - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 41
will start VHZLQJVHTXHQFHIURPEHJLQQLQJ NOTE; By pressing the Thread Cutter button while sewing, machine ZLOOVWRSDWWKHHQGRIVHTXHQFHDQGFXWWKUHDGV SINGLE SEQUENCE MODE %\SUHVVLQJWKH6LQJOH6HTXHQFHEXWWRQWKHLFRQZLOOFKDQJH WRDFLUFOHDQG - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 42
XQWLO LWSOXJV¿UPO\LQWRWKHVRFNHW 3. If needed, use the level adjusting feet so that the machine and embroidery unit are even with one another. ATTACHING THE EMBROIDERY FOOT 1. Remove the presser foot and holder. 6HHSDJH ([FKDQJHWKHQHHGOHWRDQHPEURLGHU\QHHGOHD 7KH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 43
tension will remain until you change them. Thread tension will return to pre-set when you load a design. D D A C THREAD TENSION (D) This embroidery machine adjusts thread tension automatically. However, depending on the thread or fabric being used, it B may be necessary to modify the tension - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 44
]HUVHUYHVDVDIRXQGDWLRQKROGLQJIDEULFVHFXUHO\ZKLOH the embroidery machine stitches out the design, eliminating distortion in the fabric excess is removed after embroidering, the fabric itself must be able to support the design on its own. Tear-away stabilizers are usually recommended for - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 45
QHHGOHVLQ\RXU6,1*(5® embroidery machine. d c SINGER® Chromium #2001 Size 14/90 SINGER® Chromium #2000 Size 14/90 SINGER® Chromium #2001 Size 14/90 SINGER® Chromium #2000 Size 11/80 SINGER® Chromium #2000 Size 14/90 SINGER® Chromium #2000 Size 14/90 SINGER® Chromium #2000 Size 14/90 SINGER - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 46
on the inner hoop. 3. Place stabilizer and the fabric, with the right sides facing up, on top of the outer hoop. ATTACHING THE EMBROIDERY HOOP TO THE MACHINE 1. Raise the presser foot. Raise the needle to its highest position by turning the hand wheel toward you. 2 3 1 6OLGHWKHKRRSRQWRWKH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 47
your PC. UPDATING YOUR MACHINE Periodically, updates may be made available for your machine. - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 48
, editing and stitching. D SELECTING DESIGNS 2 d e 3 b EMBROIDERY COLLECTION 3')¿OHLQ\RXU86%HPEURLGHU\VWLFN - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 49
³✓´EXWWRQDQGDWWDFKWKHKRRSLQGLFDWHGLQWKLVPHVVDJH or change hoop size setting at the Embroidery Option screen 1H[WSDJH EMBROIDERY ROTATION AND MIRRORING SCREEN 1. Press the embroidery rotate and mirroring tab. 2. Press the Rotate button. By pressing this button, the design will rotate - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 50
WRFXUUHQW positon and Embroidery Option screen. ii. Cut Position: By pressing this button, move the hoop towards you, making it easier to trim fabric when embroidering an DSSOLTXp iii. Park Position: :KHQ\RXUHPEURLGHU\LV¿QLVKHGDQG\RXZDQWWRVWRUH your machine, it will be necessary - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 51
ZDQWWKLVSUHVVWKH³;´EXWWRQH +RRS size and edits will not change and return to the Embroidery Option screen. 2 BASTING (C) %\SUHVVLQJWKHWKLUGEXWWRQDQGSUHVVLQJWKH6WDUW6WRSEXWWRQ machine will sew a basting stitch around the design area as a box. Basting enables you to secure your - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 52
WKH³✓´EXWWRQ&RQWLQXHHPEURLGHULQJE\SUHVVLQJ 6WDUW6WRSEXWWRQ A START TO SEW 7KUHDGWKHXSSHUWKUHDGZLWKWKH¿UVWFRORU CAUTION 7R threads are cut. 1 4 2 3 9. When the entire embroidery is completed, your machine cuts both threads and stops. $SRSXSLQIRUPV\RXWKDW\RXU - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 53
LETTERS - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 54
QHHGOHSODWH3UHVVWKH³✓´EXWWRQ POP-UP MESSAGES MAIN MOTOR OVERLOAD If you are sewing on very heavy fabric or if the machine is blocked when sewing, the main motor can get overloaded and the machine will stop sewing. The pop-up message will close when the main motor and power supply are secure - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 55
THE USB STICK CANNOT BE READ This pop-up will appear when your embroidery machine cannot access the LQIRUPDWLRQRQWKH86%VWLFN7KLVFDQEH FDXVHGE\ THREAD END When starting to embroider or after changing the thread, the machine will sew a few stitches and then stop so you can cut the thread end - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 56
holder into the hook race so that the tip E ¿WVWRWKHVWRSSHUF DVVKRZQ 6. Replace the needle plate inserting the hook into the machine. Replace the screws and tighten. HOOK RACE AND FEED DOG 1. Remove the needle, presser foot and holder. Remove the bobbin cover and bobbin. Remove - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 57
HELPFUL HINTS PROBLEM Upper thread breaks Lower thread breaks Machine skips stitches )DEULFSXFNHUV Machine makes loose stitches or loops 6WLWFKSDWWHUQLV distorted Threader does not thread to needle eye Machine does not feed properly Needle breaks Machine runs with GLI¿FXOW\ Machine will not run - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 58
TECHNICAL SPECIFICATION Rated voltage Nominal consumption Light 6HZLQJVSHHG Machine dimensions: /HQJWKPP :LGWKPP +HLJKWPP 1HWZHLJKWNJ 100-240V ~ 50/60Hz 55W LED USPPD[LPXP Embroidery unit dimensions: /HQJWKPP :LGWKPP +HLJKWPP - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 59
MANUEL D'INSTRUCTIONS SE300 SE340 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 60
ées, y compris les suivantes : Lisez attentivement toutes les instructions avant d'utiliser cette machine à broder à usage domestique. Conservez ces instructions près de la machine à titre de commodité. Veillez à les transmettre avec la machine si celle-ci est donnée à une autre personne. DANGER - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 61
GHYRWUHPDFKLQHjFRXGUHOLVH] LQWpJUDOHPHQWOHOLYUHWG¶LQVWUXFWLRQVDYDQWGHODIDLUHIRQFWLRQQHU(QVXLWHIDPLOLDULVH]YRXVDYHF la machine en relisant le manuel d'instructions page par page. 3RXUYRXVJDUDQWLUGHWRXMRXUVGLVSRVHUGHVIRQFWLRQVGHFRXWXUHOHVSOXVPRGHUQHVOHIDEULFDQW VH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 62
14 7(16,21'8 14 /¶$,*8,//('28 15 6,*1$/62125 16 /80,126,7e'(/¶e&5$1 16 e&5$1'(&$/,%5 16 9(56,21'8/2 16 ENFILAGE DE LA MACHINE 5e 1(77 RETRAIT DE LA CANETTE 167$//(=81(%2%,1('(),/685/$7,*(3257( %2%,1 2%,1$*('(/$&$1(77 2%,1(5/$&$1(77(,1'e3(1'$00(17 18 ,16e5 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 63
TABLE DES MATIÈRES BRODERIE PRÉPARATION DE BRODERIE 42 &211(&7(5/¶81,7e'(%52'(5 42 3285(1/(9(5/¶81,7e'(%52'(5 42 ,167$//(=/(3,('¬%52'(5 42 0(66$*(6$8'e0$55 42 e&5$1%28721'¶$&&8 43 e&5$1'¶$&&8 43 %28721'¶$&&8 43 5e*/$*(6'(/$0$&+,1(¬%52'(5 43 %28721'(5e 43 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 64
PLVHjQLYHDXHQ 34. Plaque d'aiguille GHVVRXVGHO¶XQLWp 35. Couvercle de la canette 36.Verrou du couvercle de la canette 22 31 48 52. Support des cerceaux de broderie (QVHPEOHGH¿[DWLRQGHV cerceaux de broderie 54. Prise de l'unité de broderie 23 32 24 33 25 26 34 35 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 65
pour couture parallèle 24. Longue vis de l'aiguille 25. Guide de piquage 26. Rhéostat &RUGRQG¶DOLPHQWDWLRQ &HUFHDXjEURGHUPP;PP AMOVIBLE POUR OUVRIR LE COMPARTIMENT DES ACCESSOIRES Les accessoires de la machine sont remisés dans le compartiment de la table de rallonge amovible - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 66
5. Rabaissez le levier du pied presseur et le pied presseur s'enclenchera sur le support du pied. Remarque: Cette machine à coudre est de type à pied bas. Lorsque vous magasinez pour des pieds presseurs et des accessoires optionnels SINGER, assurez-vous qu'ils sont dessinés pour un modèle à pied bas - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 67
de style et grosseur approprié au tissu à coudre. Les aiguilles de marque SINGER sont recommandées pour cette machine. Tissu Fil Modéle Grosseur d'Aiguille d'Aiguille Tissus légers: Fil polyester tout- SINGER - cotons légers, XVDJHFRWRQ¿Q Modéle 2000 voile, serge, soie, soie - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 68
contrôler le départ, l'arrêt ainsi que la vitesse de la machine en utilisant votre pied. 0HWWUHO¶LQWHUUXSWHXUHQSRVLWLRQIHUPpV\PEROH2 Mettre l'interrupteur en position fermé lorsque vous brancher le rhéostat à la machine. 2. Manipulez le rhéostat avec soin et éviter de l'échapper sur - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 69
de tissu, vous pouvez surélever le pied presseur ce qui permettra G¶LQVWDOOHUOHWLVVXSOXVIDFLOHPHQWHQGHVVRXVGXSLHGSUHVVHXU Remarque: La machine ne démarrera pas lorsque le pied presseur est OHYpVDXISRXUOHERELQDJHGHODFDQHWWH Attention: 1. N'appuyez pas sur ce bouton lorsqu'il - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 70
RX DEDLVVpH9RXVGHYULH]WRXMRXUVIDLUHWRXUQHUOHYRODQWYHUV vous. INSTALLER LA MACHINE DANS UN MEUBLE DE COUTURE (N) Vous retrouverez, en dessous de la machine, deux trous qui sont utilisé pour installer la machine dans un meuble de FRXWXUH$OLJQH]OHVWURXVWHOTX¶LQGLTXHUGDQVODSKRWR - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 71
pouvez utiliser d'autres pieds presseurs tel que décrit dans le manuel d'instruction. d. Largeur du Point/Position d'aiguille e. Longueur du Point/Densité bc ÉCRAN D'ACCUEIL (A) Lorsque vous allumez la machine, l'écran d'accueil apparaitra jO¶pFUDQ$&/YRLUSOXVEDV 'HX[ERXWRQVDSSDUDLVVHQW - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 72
HQDSSX\DQWVXUOHVERXWRQVGHVÀqFKHVVLWXHUVXUODF{WpGURLW GHO¶pFUDQ(QDSSX\DQWGHQRXYHDXVXUOH%RXWRQGH5pJODJH$ la machine retournera à l'écran précédent. Remarque: 7RXVOHVUpJODJHVH[FHSWHUFHOXLSRXUODWHQVLRQGX¿OVHURQW mémorisé jusqu'à ce que vous les changiez de nouveau - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 73
RÉGLAGE DE LA MACHINE PRÉPARATION DE LA COUTURE La Tension du Fil est Trop Lâche. /H¿OVXSpULHXUDSSDUDLWUDHQGHVVRXVGXWLVVX$XJPHQWHUOD YDOHXUGHODWHQVLRQGX¿O - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 74
correctement, un PHVVDJHV¶DI¿FKHUDjO¶pFUDQ$SSX\H]VXUOHERXWRQ³✓´HW UHIDLWHODFDOLEUDWLRQ VERSION DU LOGICIEL La version du logiciel de cette machine à broder sera indiquée en bas de cet écran. 9RXVSRXYH]PHWWUHOHORJLFLHOjMRXUHQXWLOLVDQWODFOp86% (PEURLGHU\6WLFN9RLUSDJH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 75
SINGER® Classe 15 dans cette machine. RETRAIT DE LA CANETTE 1. Tirez le verrou du couvercle de canette vers la droite et enlevez le couvercle de canette. 2. Retirez la canette de la machine. BOBINAGE DE LA CANETTE 7HQH]OH¿OGDQVOHVGHX[PDLQVHWLQVpUH]OH¿OGDQVOH guide à partir - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 76
trou sur le côté gauche et sur le dessus de la machine. 3ODFH]ODURQGHOOHGHIHXWUHHWODERELQHGH¿O LA CANETTE 1. Placez la canette dans le support de canette, en vous assurant que la canette TX¶LOFOLTXHHQSODFH Remarque: Cette machine peut commencer à coudre sans récupérer PDQXHOOHPHQW - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 77
OHYLHUGXSLHGSUHVVHXUDYDQWG¶HQ¿OHU la machine. 2. Amenez l'aiguille à sa position la OH¿ODYHFOHVGHX[PDLQVHWIDLWHVSDVVHUOH¿OGDQV le guide à partir de l'ouverture de devant. $PHQH]OH¿O Consultez la page suivante pour des instructions sur la PDQLqUHG¶XWLOLVHUO¶HQ¿OHDLJXLOOH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 78
ENFILAGE DE LA MACHINE ENFILAGE DE L'AIGUILLE ATTENTION Pour éviter les accidents: 1. N'approchez pas les FDQHWWHSOXVORQJUpFXSpUH]OH¿OGHFDQHWWHFRPPHVXLW 1. Insérez la canette dans le support de canette, comme LQGLTXpjODSDJHPDLVQHFRXSH]SDVOH¿O 2. Relevez le pied presseur. - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 79
DÉMARRAGE DE LA COUTURE À QUEL ENDROIT UTILISER CHAQUE POINT Direct (0-9) 0.Le point droit position centrale. • Pour la surpiqûre, point de couture de base, couture de IHUPHWXUHJOLVVLqUHHWF 1.Point zigzag • Pour le surjet, les appliqués, etc. 2XUOHW,QYLVLEOH 3. Surjeter 6XUMHWHUXQ - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 80
XWLOLVH]SOXW{WOHFRXSH¿OTXLVH trouve sur le côté gauche de la machine. (Voir page 12) 3. 1HMDPDLVXWLOLVHUOHERXWRQGX&RXSH¿OORUVTXH OD¿QG¶XQHFRXWXUHDSSX\HU sur le bouton de Marche/Arrêt pour arrêter la machine ou relâcher le rhéostat. $SSX\H]VXUOHERXWRQGX&RXSH¿O 5. - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 81
d'Arrêt. La lumière DEL s'allumera. 2. Débutez la couture. La machine coudra des points d'arrêt et s'arrêtera automatiquement. COUDRE UN TISSUS LOURD Lorsque zone de chevauchement. LARGEUR DE LA DISTANCE DE COUTURE Les lignes guide sur la plaque aiguille indique la distance à partir de la position - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 82
de renverse incorporé. 3LHG7RXW8VDJH$ /RUVTXHYRXVDXUH]DWWHLQWOD¿QGHODFRXWXUHDSSX\pVXUOH bouton de Marche-arrière. La machine coudra quelques points de reculons et quelques points vers l'avant et s'arrêtera de coudre automatiquement. $SSX\H]HWUHOkFKHUOHERXWRQGX&RXSH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 83
ODYLVI SRXUDMXVWHUOHSLHGGHIDoRQ jFHTXHO¶DLJXLOOHWRXFKHOpJqUHPHQWOHERUGGXUHSOLJ Alignez et appuyer le tissu sur la tige guide du pied surjet en vous assurant que l'aiguille transperce le tissu très près du rebord. 1R/DUJHXU HVWXWLOLVpSRXUSUpYHQLUTXHOHWLVVX - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 84
COUTURE ATTENTION Pour éviter les accidents, le Pied Surjet doit être utilisé pour les points 1, 3, 33, 35 et 36 seulement. Ne changez pas les réglages du point. Il est possible que l'aiguille puisse frapper le pied presseur et se brise lorsque d'autres points ou d'autres réglages sont utilisé. EN - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 85
COUTURE COUTURE POINT EXTENSIBLE Les points extensibles sont résistants, souples et pourront REpLUDXWLVVXVDQVVHEULVHU%RQSRXUOHVWULFRWVDLQVLTXHOHV tissus résistants tels le denim ou le sergé. No. 6 Point Droit Extensible No. 32 Point de Tige pour tissu Extensible No. 40 Point Ric Rac - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 86
pour éviter que le bouton soit trop serré sur le tissu. Insérez par le devant du pied, une épingle droite ou une aiguille de machine à coudre dans la rainure centrale du pied. Coudre au-dessus de l'épingle ou de l'aiguille. Pour soulever OHERXWRQWLUH]OH¿OYHUVO¶DUULqUHGXERXWRQ - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 87
le pied presseur, ce qui pourrait avoir comme résultat que l'aiguille se brise ou endommage la machine. )L[H]OHSLHGjIHUPHWXUHJOLVVLqUH Enclenchez la tige du côté gauche du pied presseur dans le support du pied presseur pour coudre sur le côté droit de la IHUPHWXUHJOLVVLqUHHWODWLJHGX - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 88
IDLWjODPDLQ 3LHG3RLQW'URLW3DWFKZRUN Guide de piquage. 5. Tournez l'endroit du sultat que l'aiguille se brise ou endommage la machine. ASSEMBLAGE DES MORCEAUX DE TISSU Joindre les piè JXLGHGHSLTXDJHQHO¶LQVpUDQWGDQVOH trou du support du pied presseur et ajuster-le à l'espacement désir - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 89
. 4. Abaissez complètement le levier de la boutonnière. 5(0$548( La machine ne démarrera pas la couture si le levier de la boutonnière n'est pas compl UHSULVDJH comme démontré. La machine s'arrêtera automatiquement ORUVTXHOHPRWLIVHUDWHUPLQp 1. Ajustez la plaque-guide du pied à boutonnière - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 90
style de boutonnière que vous désirez coudre. Cette machine peut coudre 13 types de boutonnière. %RXWRQQLqUHUHQIRUFLH/DUJH du point. 5. Abaissez complètement le levier de la boutonnière. 5(0$548( La machine ne démarrera pas la couture si le levier de la boutonnière n'est pas complétement - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 91
tracé préalablement. a. L'endroit du tissu. b. L'envers du tissu. 2. Abaissez le levier de la boutonnière et cousez la ERXWRQQLqUH9RLUODSDJHSUpFpGHQWH La machine va coudre la boutonnière dans l'ordre tel TX¶LOOXVWUpHWV¶DUUrWHUDDXWRPDWLTXHPHQWjOD¿QGHOD couture. 12 3 4 33 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 92
$SSX\H]VXUOHERXWRQGX&RXSH¿OHWVRXOHYH]OHSLHG presseur pour retirer le tissu. COUTURE 10. Pliez le tissu et coudre le long de la couture de chaque côté, à une distance d'une largeur d'aiguille de la couture original. c. L'envers du tissu. 5HSOLH]OHWLVVXOHORQJGHOD¿QGHOD - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 93
39-249 3LHGSRLQW%RXUGRQ% 1. Insérez le tissu en dessous du pied presseur et abaisser le pied presseur. Débutez la couture. La machine coudra l'œillet et s'arrêtera automatiquement. 3RXUSHUVRQQDOLVH]OHVFRXWXUHVHQFRQWLQXHGHPRWLIGpFRUDWLI vous pouvez ajuster la longueur et la largeur du - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 94
pour Couture Parallèle. 2. Coudre le premier rang. 3. Faites correspondre le premier rang de couture soit entre ou sur l'une des lignes rouge guide sur le pied, dépendamment de l'espacement désiré entre le premier rang cousu. Coudre le prochain rang en utilisant l'une des OLJQHVURXJHJXLGHFRPPH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 95
SDVIRXUQLDYHFFHWWHPDFKLQH ATTENTION Pour prévenir les accidents: a. Utilisez seulement des aiguilles doubles de marque SINGER sur cette machine. D'autres types d'aiguille pourraient se briser. E1¶XWLOLVH]SDVO¶HQ¿OHXUG¶DLJXLOOH(Q¿OH]FKDTXHFKDV d'aiguille manuellement. 10. Appuyez - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 96
EN SÉQUENCE COUTURE SÉQUENTIEL 9RXVSRXYH]FRPELQHUGHVPRWLIVHWGHVOHWWUHVGDQVXQH même séquence. Pour entrer dans le mode séquentiel, appuyer sur le bouton de Séquence dans l'écran d'Accueil. Vous verrez l'écran ACL le mode Séquentiel. 4. Appuyez directement sur la lettre désirée. Appuyez - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 97
EN SÉQUENCE DÉPLACEZ LE CURSEUR (EN SURBRILLANCE) /DSRVLWLRQGXFXUVHXUHVWGpWHUPLQpHSDUODOHWWUHRXOHPRWLI qui est en surbrillance. Le curseur se déplacera vers le haut ou le bas en appuyant VXUOHVFXUVHXUVDE Les curseurs sont utilisés pour sélectionné, inséré, supprimé RXpGLWp - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 98
¿FKLHUVGHPpPRLUHVSRXUVDXYHJDUGHUYRV séquences de points. Une séquence mémoriser demeure dans la mémoire même si vous éteignez la machine. /RUVTXHOHQXPpURGX¿FKLHUHVWHQVXUEULOODQFHDSSX\H] sur le bouton "✓´ 4. La séquence ainsi sélectionnée apparait à la gauche de l'écran - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 99
,QVWDOOH]XQSLHGjSRLQW%RXUGRQORUVTXHYRXVFRXVH]GHV SRLQWVGpFRUDWLIVHWGXOHWWUDJH 2. Abaissez le pied presseur et débuter la couture. La machine entreprendra la couture au début de la séquence et coudra cette séquence à répétition. 5(0$548( (QDSSX\DQWWRXWHQFRXVDQWVXUOHERXWRQGX - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 100
GDQVODSULVH $XEHVRLQXWLOLVH]OHSLHGGHUpJODJHGHQLYHDXD¿QTXHOD machine et l'unité de broderie soient au même niveau. INSTALLEZ LE PIED À BRODERIE 1. Enlevez le pied presseur et le support. 9RLUSDJH 5HPSODFH]O¶DLJXLOOHSDUXQHDLJXLOOHjEURGHUD /HEUDVE GXSLHG - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 101
unité de broderie est posée. Elle pourrait tomber. 2. Ne poussez pas et ne tirez pas le support en appliquant trop de force. Il pourrait se casser. 3. Ne tenez pas la machine par le support pour la déplacer. ÉCRAN/BOUTON D'ACCUEIL ÉCRAN D'ACCUEIL (A) 8QHIRLVTXHYRXVDYH]SRVpFRUUHFWHPHQWO¶XQLWp - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 102
L'ÉCRAN VERSION DU LOGICIEL Ces réglages sont les même que dans le mode machine. Voir page 16. TISSU ET ENTOILAGE Il est possible de broder sur de nombreux sont permanents et représentent donc un meilleur choix pour supporter la broderie sur des WLVVXVLQVWDEOHVD¿QG¶HPSrFKHUOHVGpIRUPDWLRQV,O - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 103
2001 dans les grosseurs 11/80 ou 14/90 au lieu des aiguilles SINGER® Style 2045. Il est recommandé d'utiliser des aiguilles SINGER® pour la machine à broder SINGER® d c TABLEAU DE TISSU, ENTOILAGE, AIGUILLE ET FIL OUVRAGE ENTOILAGE MISE EN CERCEAU T-shirts Maille douce à découper - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 104
OHFDGUHLQWpULHXU 3. Placez l'entoilage et le tissu, endroit vers le haut, sur le cadre extérieur. FIXER LE CERCEAU DE BRODERIE À LA MACHINE 1. Relevez le pied presseur. Amenez l'aiguille à sa position la plus haute en tournant le volant vers vous. 2 3 1 2. Faites glisser le cerceau sur l'unit - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 105
PRÉPARATION DE BRODERIE CLÉ USB EMBROIDERY STICK 9RWUHPDFKLQHHVWIRXUQLHDYHFXQHFOp86%&H&HWWHFOp est disponible pour votre machine ; il YRXVSHUPHWWUDG¶XWLOLVHUOHVPRWLIVG¶DXWUHVVRXUFHVWHOVTXH GHVPRWLIVVXU&'HWVXU,QWHUQHW Allez à singer.mysewnet.comSRXUGHVLQIRUPDWLRQV - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 106
DYHFSOXVGHPRWLIVGH broderies, ainsi que des polices de broderie. Vous trouverez 69 de ces dessins, plus les polices insérés dans la machine. /HUHVWHGHVPRWLIVGHEURGHULHVRQWVXUODFOp86% /DFOp86%DDXVVLGRVVLHUV3')DYHFOHVLQIRUPDWLRQVVXU OHVGHVVLQV3RXUSOXVG¶LQIRUPDWLRQ - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 107
MODIFIER LE MOTIF $YDQWGHFRPPHQFHUjEURGHUYRXVSRXYH]PRGL¿HUOHV PRWLIVFRPPHLQGLTXpFLGHVVRXVHQXWLOLVDQWOHVRQJOHWV 0RGL¿HU 5(0$548( OHPHVVDJHFRQWH[WXHOV¶DI¿FKHVLYRXVQ¶DYH]SDVSRVpOHERQ cerceau. $SSX\H]VXUOHERXWRQ©✓ªHWSRVH]OHFHUFHDXLQGLTXpGDQV FHPHVVDJHRX - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 108
vous brodez un appliqué. iii. Position de stationnement : Lorsque votre broderie est terminée et que vous voulez ranger votre machine, il est nécessaire de déplacer le support du cerceau en position de stationnement. Appuyez sur le bouton de position de stationnement. Lorsque le PHVVDJHFRQWH[WXHO - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 109
En appuyant sur le troisième bouton et sur le bouton Marche/ Arrêt, la machine coudra un point de bâti autour de la zone du PRWLIVRXVIRUPHGH tre PLVHHQSODFHGDQVOHFHUFHDX/HEkWLSHXWpJDOHPHQWIRXUQLU un support supplémentaire, surtout pour les tissus instables. 5(0$548( SHQGDQWOHEkWL - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 110
Abaissez le releveur du pied presseur. 7HQH]OH¿OVXSpULHXU 5. Dégagez assez d'espace pour les mouvements du support de broderie et du cerceau. 8. Lorsque la broderie est terminée, la machine s'arrête DXWRPDWLTXHPHQWHWFRXSHOH¿OVXSpULHXU 8QHIHQrWUHFRQWH[WXHOOHV¶DI¿FKHHWYRXVLQYLWH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 111
GLIIpUHQWV SÉLECTIONNER LES LETTRES DE BRODERIE 1. Appuyez sur le bouton de police sur l'écran d'accueil. L'écran GHVpOHFWLRQGHPRWLIV¶DI¿FKH 2. Cette machine possède 2 polices et chaque police est disponible en 3 tailles. Appuyez sur le bouton de police que vous voulez coudre et DSSX\H]VXUOH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 112
s'arrête de coudre. Le message FRQWH[WXHOVHIHUPHXQHIRLVTXHOHPRWHXU principal et l'alimentation électrique sont redevenus sûrs. LA MACHINE EST RÉGLÉE SUR L'AIGUILLE DOUBLE Ce message contextuel apparait lorsque le mode de l'Aiguille Double est activé. 9pUL¿HUTXHYRXVDYH]ODERQQHDLJXLOOH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 113
à aller en dehors des limites du cerceau installé. Pour que le support de broderie se déplace librement, retirez le cerceau et appuyez ensuite vous pourriez DYRLUXWLOLVpXQHFOp86%TXLQ¶HVWSDV compatible avec cette machine. DONNÉES CORROMPUES &HPHVVDJHFRQWH[WXHOV¶DI¿FKHORUVTXH OHFRQWHQXGH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 114
appelez votre revendeur SINGER® autorisé pour réaliser l'entretien. ,OQ¶HVWSDVQpFHVVDLUHGHOXEUL¿HUFHWWHPDFKLQH SUPPORT DE CANETTE machine. Remettez les vis et serrez. 5 6 COMPARTIMENT DU CROCHET ET DES GRIFFES D'ENTRAÎNEMENT 1. Enlevez l'aiguille, le pied presseur et son support - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 115
¿FLOHPHQW Poussière ou peluche accumulée dans le compartiment à crochet. Enlevez la plaque à aiguille et le support de 56 canette et nettoyez le compartiment à crochet. La machine ne IRQFWLRQQHSDV Le cordon d'alimentation n'est pas branché ,QVpUH]OD¿FKHFRPSOqWHPHQWGDQVODSULVHpOHFWULTXH - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 116
7HQVLRQQRPLQDOH ±9a+] Consommation nominale 55W eFODLUDJH /(' Vitesse de couture 800 tr/min maximum Dimensions de la machine : /RQJXHXUPP /DUJHXUPP +DXWHXUPP 3RLGVQHWNJ Dimension de l'unité de broderie. /RQJXHXUPP - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 117
ES MANUAL DE INSTRUCCIONES SE300 SE340 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 118
después de su uso y antes de la limpieza, antes de quitar cubiertas o cuando se hagan otros ajustes de servicio mencionados en el manual de instrucciones. ADVERTENCIA Reduzca el riesgo de quemaduras, incendio, corto circuito o lesiones a personas: • No permita que se use como juguete. Se requiere - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 119
uso doméstico y le proveerá de un excelente desempeño al coser materiales ligeros como gruesos así como bordados y rotulados. Refiérase a este manual para el uso adecuado y óptimo desempeño. Para sacar el máximo provecho de su máquina, lea completamente las instrucciones antes de operar la máquina - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 120
ES TABLA DE CONTENIDO AJUSTANDO LA MÁQUINA PARTES PRINCIPALES 6 ACCESORIOS 7 MESA DE EXTENSIÓN REMOVIBLE 7 ABRIR LA CHAROLA DE ACCESORIOS 7 QUITAR LA MESA DE EXTENSIÓN 7 CHAROLA DE ACCESORIOS UNIDAD DE BORDADO .... 7 CAMBIANDO EL PRENSATELAS 8 QUITANDO EL PRENSATELAS 8 AGUJAS 9 QUITANDO E - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 121
TABLA DE CONTENIDO ES BORDADO PREPARACIÓN DEL BORDADO 42 CONECTANDO LA UNIDAD DE BORDADO 42 QUITAR LA UNIDAD DE BORDADO 42 COLOCACIÓN DEL PIE DE BORDADO 42 MENSAJES AL INICIO 42 BOTÓN PANTALLA INICIAL/INICIO 43 PANTALLA INICIAL 43 BOTÓN PANTALLA INICIAL 43 AJUSTES DE LA BORDADORA 43 BOTÓN - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 122
ES 1. Placa Frontal 2. Regulador de Presión 3. Cubierta Superior 4. Palanca Tira Hilo (interior) 5. Elevador Prensatelas 12 3 4 5 6. Pantalla Táctil LCD 7. Volante 8. Mesa de Extensión Removible 9. LEDs 10. Botones 10 teclas 6 7 PARTES PRINCIPALES 37. Sujetador del Porta Carrete 42. Porta - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 123
AJUSTANDO LA MÁQUINA ACCESORIOS Algunos accesorios se guardan en la charola de accesorios. 1. Paquete de agujas 2. 5 Bobinas SINGER Clase 15 (transparentes) (una está en la máquina) 3. Descosedor 4. Cepillo 5. Destornillador 6. Red para hilo 7. Porta Carrete Auxiliar 8. Rondanas de Fieltro 9. - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 124
destornillador. 5. Baje el prensatelas y entonces el prensatelas encajará en su sitio. NOTA: Esta máquina de coser es de zanco bajo. Cuando adquiera prensatelas y accesorios opcionales SINGER, asegúrese que están diseñados para modelos de zanco bajo. 8 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 125
é derecha. TELA, HILO Y TABLA DE AGUJAS Seleccione el tamaño de aguja e hilo de acuerdo con la tela que coserá. Se recomienda el uso de agujas SINGER para esta máquina. Tipo de Tela Hilo Tipo de Aguja Tamaño de Aguja Delgadas, geor- Todo uso gette, organdil, poliéster, voile, tafeta, algod - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 126
ES CONEXIÓN ELÉCTRICA PELIGRO Para reducir el riesgo de corto circuito: Nunca deje sin atender cuando esté conectada. Siempre desconecte la máquina del tomacorriente cuando deje de usarla y antes del mantenimiento. ADVERTENCIA Para reducir el riesgo de quemaduras, incendio y corto circuito o - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 127
AJUSTANDO LA MÁQUINA AJUSTANDO LA MÁQUINA ES FUNCIONES DE CONTROL DE LA MÁQUINA BOTÓN HILVANADO CON LED Presiones el botón de hilvanado mientras cose y la máquina coserá unas cuantas puntadas de Hilvanado y se detiene automáticamente. Cuando se presiona mientras no se cose, la máquina coserá un - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 128
ES AJUSTANDO LA MÁQUINA CORTADOR DE HILO (I) Use este cortador si no se usa el botón Cortador de Hilo. 1. Levante el prensatelas y lleve la tela y los hilos hacia atrás después de la costura. 2. Enganche los hilos en el cortador de atrás al frente. 3. Jale las puntas de los hilos para cortar las - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 129
Patrón c. Prensatelas Recomendado Indica si el prensatelas es el sugerido para costura normal. Puede usar otro prensatelas como se describe en este manual de instrucciones. d. Ancho de Puntada/Posición de la Aguja e. Largo de Puntada/Densidad bc PANTALLA INICIAL (A) Cuando enciende la máquina, se - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 130
ES AJUSTE DEL PATRÓN DE PUNTADA Su máquina selecciona automáticamente los ajustes óptimos para cada puntada. Puede hacer ajustes a cada puntada como desee. Las configuraciones ajustadas afectan sólo a la puntada seleccionada y se reiniciará al valor por omisión cuando se seleccione otra puntada. Los - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 131
AJUSTANDO LA MÁQUINA PREPARACIÓN PARA COSER Tensión muy Floja de Hilo Superior El hilo superior aparecerá en el lado inferior de la tela. Aumente la tensión del hilo superior. ES AGUJA DOBLE Active el programa aguja doble presionando los botones + o - para ajustar el ancho de la aguja doble. - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 132
ES "BIP" AUDIBLE Puede apagar el bip audible presionando este botón. i. Bip Audible encendido. ii. Bip Audible apagado. i ii CONTRASTE DE LA PANTALLA Puede ajustar el contraste de la pantalla. Presionando el botón "+" o "-", el contraste aumentará o disminuirá. PREPARACIÓN PARA COSER PANTALLA DE - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 133
AJUSTANDO LA MÀQUINA ENSARTANDO LA MÁQUINA ES COLOCACIÓN DE BOBINA Asegúrese de usar sólo bobinas SINGER Clase 15 (transparentes) en esta máquina. QUITANDO LA BOBINA 1. Jale el seguro de la cubierta bobina a la derecha y quite la cubierta de la bobina. 2. Levante - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 134
: Esta máquina puede empezar a coser sin jalar el hilo bobina. Si desea jalar el hilo bobina, vea la página 20. Asegúrese de usar bobinas SINGER Clase 15 transparentes en esta máquina. 18 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 135
AJUSTANDO LA MÁQUINA ENSARTANDO LA MÁQUINA ES ENSARTANDO LA AGUJA PREPARACIÓN PARA ENSARTAR LA MÁQUINA 1. LEVANTE EL PRENSATELAS. Es muy importante levantar el prensatelas antes de proceder a ensartar la máquina. 2. Levante la aguja a su posición más alta girando el volante hacia usted. (Mantenga - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 136
ES ENSARTANDO LA MÁQUINA ENSARTANDO EL OJO DE LA AGUJA PRECAUCIÓN Para evitar accidentes: 1. Mantenga los dedos lejos de partes móviles. Se requie- re especial cuidado alrededor de la aguja. 2. No baje la palanca del ensartador mientras la máquina está operando. NOTA: El ensartador de aguja se usa - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 137
COMENZANDO A COSER DONDE USAR CADA PUNTADA Directa (0-9) 0.Puntada recta posición de aguja al centro • Para pespunte, costura clásica, cierres, etc. 1.Puntada Zig zag • Para remates, aplicaciones, etc. 2.Dobladillo invisible 3.Tipo overlock 4.Remate para tela elástica, puntada decorativa 5.Puntada - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 138
ES COMENZANDO A COSER COMENZANDO A COSER Seleccione puntada recta posición de aguja al centro PRECAUCIÓN Para prevenir accidentes: Mientras cose, se requiere de atención especial en el área de la aguja. La máquina avanza la tela automáticamente, no jale o empuje la tela. INICIO Y FIN DE LA COSTURA - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 139
COSIENDO COMENZANDO A COSER ES PUNTADA REFUERZO Puede coser puntadas de refuerzo al comienzo y al final de la puntada 1. Presione el botón Refuerzo. Se iluminará el LED. 2. Comience a coser. COSIENDO TELAS GRUESAS Cuando cose telas gruesas, el extremo del dedo del prensatelas tiende a levantarse - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 140
ES COSIENDO COSIENDO PUNTADA RECTA Los patrones de puntada recta deben seleccionarse de acuerdo al tipo de tela que se coserá. Posición aguja izquierda (No. 10, 13) es más adecuada para costura de telas delgadas. No. 0. Posición de aguja al centro No. 10. Posición de aguja a la izquierda No. 12. - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 141
COSIENDO COSIENDO PUNTADA DOBLADILLO INVISIBLE El dobladillo se cose sin que se muestren la puntadas en el anverso de la tela. No. 2 Dobladillo invisible para telas no elásticas No. 8 Dobladillo invisible para telas elásticas. Pie de Dobladillo Invisible (D) ES 4. Baje el prensatelas y cosa el - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 142
ES PRECAUCIÓN Para prevenir accidentes, el Pie de Remallado debe usarse para coser patrones 1, 3, 33, 35, 36 solamente. No cambie los ajustes de puntada. Es posible que la aguja golpee el prensatelas y se rompa cuando se cosen otros patrones y ajustes. USANDO EL PIE UNIVERSAL No. 1, 4, 7, 15, 34, 37 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 143
COSIENDO ES COSIENDO PUNTADA ELÁSTICA Las puntadas elásticas son fuertes, flexibles y se estiran con la tela sin romperse. Buena para tejidos de punto así como telas durables como la mezclilla o loneta. No. 6 Puntada Recta Elástica No. 32 Puntada de Racimo para Telas Elásticas No. 40 Puntada Ric- - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 144
ES COSIENDO BOTONES No. 11 Pie Pega Botones COSIENDO PRECAUCIÓN Para revenir accidentes: Ase rese e a a a n e ad de tr d a a ee e a se r t n d rante e er 7. Levante el pie y corte los hilos dejando un restante de cerca de 10 cm. (4") de largo. 1. Baje los impelentes moviendo la palanca de - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 145
COSIENDO PEGANDO CIERRES INSERCIÓN CENTRADA No. 0 Puntada Recta (Posición de Aguja al Centro) ES 5. Cosa sobre el extremo inferior y lado derecho del cierre. Quite el hilvanado y presione. 7-10 mm COSIENDO INSERCIÓN TRASLAPADA PRECAUCIÓN Para prevenir accidentes, no cambie la posición de la - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 146
ES COSIENDO 3. Coloque el Pie Pega Cierres. Coloque el lado derecho del perno prensatelas al sujetador del prensatelas cuando cosa el lado derecho del cierre y el lado derecho del perno prensatelas al sujetador cuando cosa el lado izquierdo del cierre. 4. Cosa el lado izquierdo del cierre de abajo - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 147
COSIENDO COSIENDO ES ZURCIDO Y REMATE AUTOMÁTICO Puede coser remate automático y zurcido usando el Pie de Ojales. No. 16 Refuerzo, para reforzar áreas sujetas a tensión, como esquinas de bolsillos. No. 17 Zurcido, remiendo y otras aplicaciones. Pie de Ojales. 4. Baje la palanca del Ojal - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 148
ES COSIDO DE OJALES Seleccione el estilo de ojal que desea coser. Esta máquina puede coser 13 tipos de ojales. 18. Ojal de refuerzo (Amplio) 19. Ojal de refuerzo (Estrecho) 20. Ojal de Cerradura 21. Ojal de Cerradura con cruce 22. Ojal Extremo Cónico 23. Ojal Extremo Redondo (Estrecho) 24. Ojal - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 149
COSIENDO COSIENDO 1 2 3 4 1 2 3 4 1 2 3 4 5 1 2 3 1 2 3 4 1 2 3 4 5 1 2 3 4 5 ES NOTA: Para coser ojales en telas difíciles de coser o a lo largo del borde de prendas con múltiples capas, instale el Bajo Placa. Coloque la tela entre el Bajo Placa y el Pie de Ojales. - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 150
ES COSIENDO 3. Presione el botón Cortador de Hilo y levante el prensatelas para quitar la tela. 10. Doble la tela y cosa a lo largo de las costuras en cada lado, sólo el ancho de una aguja de la línea de puntada original. Retire el hilvanado. c. Lado reverso de la tela. 11. Doble la tela a lo - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 151
COSIENDO COSIENDO ES OJILLO Este patrón de puntada se usa para marcar orificios de cinturón y otras aplicaciones similares. 31 Ojillo Pie Festón (B) Puede elegir 3 tamaños de ojillos cambiando el largo de puntada. PATRÓN DECORATI O CONTINUO Use el Pie Festón para patrones de puntadas decorativas - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 152
ES COSIENDO APLICACIONES No. 200, 201, 202 Pie Abierto PRECACIÓN Para prevenir accidentes, no cambie el ancho puntada a más de 5.0. De otro modo, la aguja puede golpear el prensatelas y romperse. COSTURA DE BRAZO LIBRE Quitando simplemente la mesa de extensión, puede accesar al brazo libre, - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 153
o Pie Festón (A, B) NOTA: Una aguja doble no se proporciona con esta máquina, ES PRECAUCIÓN Para prevenir accidentes: a. Use sólo agujas dobles SINGER para la máquina. Otras pueden romperse b. No puede usarse el ensartador de aguja. Ensarte cada ojo manualmente. 10. Presione el botón Ajuste. 11 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 154
ES SECUENCIADO SECUENCIADO Puede combinar patrones de puntada y de letras en una secuencia. Para entrar al modo de secuencia, presione el Botón Secuencia en la Pantalla Inicial. La pantalla mostrará la Pantalla de Secuencia. 4. Presione la letra deseada directamente. Presione las pestañas de - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 155
SECUENCIADO ES CAMBIANDO EL CURSOR La posición del cursor es el patrón resaltado o letra. Presionando los botones de Cursor (a, b), el cursor cambiará hacia arriba o abajo. El cursor se usa para revisar patrones seleccionados, inserción de patrones, borrado de patrones o edición como se describe - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 156
ES SECUENCIADO AJUSTANDO CADA PATRÓN O LETRA EN UNA SECUENCIA Puede cambiar los ajustes (ancho/largo puntada, espejo/reversa) de cada patrón de puntada. 1. Coloque el cursor en el patrón que desea editar. 2. Cambie el ajuste como ajuste normal. (página 14) b. Para rellamar una secuencia - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 157
SECUENCIADO ES COSER LA SECUENCIA Después de seleccionar las puntadas para una secuencia, la secuencia se coserá en repetición. COSIENDO 1. Coloque el Pie Festón cuando cosa puntadas decorativas y letras. 2. Baje el prensatelas y comience a coser. La máquina comenzará a coser desde el principio de - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 158
ES PREPARACIÓN PARA BORDADO Su máquina puede convertirse a modo de bordado con facilidad colocando la unidad de bordado como sigue. CONECTANDO LA UNIDAD DE BORDADO COLOCANDO EL PIE DE BORDADO 1. Quite el prensatelas y sujetador. (ver página 8) Intercambie la aguja por una aguja de bordado (a). 2. - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 159
PREPARACIÓN PARA BORDADO PRECAUCIÓN Para revenir accidentes: N eva a ina c and a nidad de rdad est c cada P ede caerse N e e ni a e e carr c n er a P ede r erse N a arre de carr ara ver a ina PANTALLA INICIAL BOTÓN INICIAL PANTALLA INICIAL A Cuando haya colocado correctamente la unidad de - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 160
ES PREPARACIÓN PARA BORDAR LADO ANVERSO LADO REVERSO i USANDO TELA Y ENTRETELA El bordado puede aplicarse a diferentes tipos de tela. Sin importar la tela, será necesario usar una entretela adecuada. (Ver página 45 para más información) La entretela sirve como una base, sosteniendo la tela firme - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 161
exceso de entretela del área de bordado. a. Entretela b. Posición del aro c. Tela (lado inferior) d. Superficie de bordado (lado superior) NOTA: Es posible sustituir las agujas SINGER Estilo 2020 por las de el Estilo 2000, ya sea en tamaños 11/80 o 14/90. Es posible sustituir agujas - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 162
ES PREPARACIÓN PARA BORDADO ASEGURANDO LA TELA EN EL ARO DE BORDADO COLOCANDO EL ARO DE BORDADO A LA MÁQUINA Para mejores resultados de bordado, coloque una capa de entretela debajo de la tela. Cuando ponga en el aro entretela y tela asegúrese que esté terso y bien asegurado. 1. Abra la Palanca - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 163
está disponible para su máquina, que le permitirá usar diseños de otras fuentes, como CDs con diseños o de la Internet. Vaya a singer.mysewnet.com para información de cómo descargar este software en su PC. ACTUALIZANDO SU MÁQUINA Puede haber actualizaciones periódicas disponibles para su máquina. Su - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 164
ES PANTALLA INICIAL La selección de diseños para bordar inicia en la Pantalla Inicial. La Pantalla Inicial tiene dos selecciones principales. a. Selección de un diseño, edición y bordado. b. Programación de letras, edición y bordado. SELECCIONANDO DISEÑOS 2 d a e 3 b COLECCIÓN DE BORDADOS ( - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 165
EDITANDO EL DISEÑO ES Antes de comenzar a bordar, puede editar diseños, como se muestra abajo, usando las Pestañas Editar. NOTA: Aparecerá un mensaje si no coloca el aro correcto. Presione el botón "✓ " y coloque el aro indicado en este mensaje o cambie el ajuste del tamaño del aro en la pantalla - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 166
ES PANTALLA OPCIÓN DEL BORDADO 1. Presione la pestaña Opción del Bordado. 2. Puede entrar a las opciones de bordado presionando los botones como se muestra a continuación A. Opción y Selección de Aro B. Trazado C. Hilvanado D. Monocromático A B C D OPCIÓN SELECCIÓN DE ARO A El botón superior derecho - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 167
EDITANDO EL DISE O SELECCIÓN DE ARO Cuando selecciona el diseño, la máquina seleccionará el aro más adecuado de forma automática. 1. Para cambiar el aro, presione la segunda pestaña para abrir el listado de aros. ES TRA ADO B La función de Trazado puede usarse para trazar alrededor del área de dise - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 168
ES BORDANDO UN DISEÑO Cuando completa la edición del diseño, presione la pestaña Bordar para iniciar el bordado. PANTALLA BORDAR Cuando presiona la pestaña Bordar (A), aparecerá la pantalla de Bordado. a. Campo y posición de bordado. b. Puntadas en bloque de color / Número total de puntadas en el - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 169
BORDADO DE LETRAS ES Puede seleccionar de dos diferentes tipos de letra. Vea la colección de bordado. SELECCIONANDO BORDADO DE LETRAS 1. Presione el botón Fuente en la Pantalla Inicial. Aparecerá la pantalla Selección de Fuente. 2. Esta máquina tiene 2 fuentes y cada una tiene 3 tamaños. Presione - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 170
ES LAVANTAR LA AGUJA Si la aguja está en posición abajo y necesita levantarse antes que pueda ejecutarse la función, se muestra este mensaje. Levante la aguja y presione el botón "✓" para cerrar el mensaje. LEVANTAR EL PRENSATELAS Este mensaje aparece cuando la función que se ha elegido requiere que - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 171
MENSAJES EMERGENTES BORRAR PROGRAMA Cuando se borran todos los patrones, aparece un mensaje, presione el botón "✓". La máquina borra todos los patrones seleccionados y letras. Para cancelar presione el botón "X". SOBRESCRIBIR Si la carpeta seleccionada tiene una secuencia memorizada, aparece un - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 172
una lámpara LED para iluminar el área de costura. No requiere remplazo. En el remoto caso que no encienda contacte al centro de servicio SINGER autorizado. * No hay necesidad de lubricar la máquina. 3. Levante el porta bobina y quítelo. PRECAUCIÓN Para evitar accidentes, no toque la unidad de corte - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 173
CONSEJOS ÚTILES ES PROBLEMA El hilo superior se rompe El hilo inferior se rompe La máquina se brinca puntadas La tela se frunce La máquina suelta puntadas o bucles El patrón de puntada está distorsionado El ensartador no ensarta el ojo de la aguja La máquina no avanza adecuadamente La aguja se - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 174
(mm) 310 Peso Neto (kg) 8.4 Dimensiones unidad de bordado: Largo (mm) 470 Ancho (mm) 506 Alto (mm) 127 Peso neto (kg) 3.2 Las especificaciones técnicas y este manual de instrucción pueden cambiar sin aviso previo. 58 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 175
'HVLJQ stitches:10669 Dim.:13X13 cm 'HVLJQ stitches:11578 Dim.:10X10 cm 'HVLJQ stitches:4655 Dim.:8X8 cm 'HVLJQ stitches:9000 Dim.:9X7 cm 'HVLJQ stitches:11845 Dim.:11X11 cm 'HVLJQ stitches:13842 Dim.:12X12 cm 'HVLJQ stitches:6550 Dim.:8X8 cm 'HVLJQ stitches:10678 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 176
'HVLJQ stitches:16164 Dim.:14X16 cm 'HVLJQ stitches:11588 Dim.:8X10 cm 'HVLJQ stitches:10385 Dim.:10X10 cm 'HVLJQ stitches:19565 Dim.:12X20 cm 'HVLJQ stitches:15284 Dim.:13X23 cm 'HVLJQ stitches:2386 Dim.:4X4 cm 'HVLJQ stitches:8812 Dim.:10X10 cm 'HVLJQ stitches:6909 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 177
'HVLJQ stitches:4536 Dim.:10X10 cm 'HVLJQ stitches:8683 Dim.:14X18 cm 'HVLJQ stitches:8963 Dim.:14X22 cm 'HVLJQ stitches:11607 Dim.:10X17 cm 'HVLJQ stitches:2946 Dim.:14X19 cm 'HVLJQ stitches:6953 Dim.:14X13 cm 'HVLJQ stitches:12848 Dim.:9X21 cm 'HVLJQ stitches:5718 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 178
'HVLJQ stitches:11642 Dim.:15X20 cm 'HVLJQ stitches:1634 Dim.:9X9 cm 'HVLJQ stitches:835 Dim.:15X15 cm 'HVLJQ stitches:813 Dim.:14X15 cm 'HVLJQ stitches:6665 Dim.:15X15 cm 'HVLJQ stitches:4816 Dim.:8X14 cm 'HVLJQ stitches:1943 Dim.:10X9 cm 'HVLJQ stitches:1474 Dim.: - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 179
'HVLJQ stitches:1665 Dim.:10X10 cm 'HVLJQ stitches:3300 Dim.:14X14 cm 'HVLJQ stitches:1873 Dim.:X9 cm 'HVLJQ070 stitches:1786 Dim.:8X8 cm 'HVLJQ073 stitches:1677 Dim.:9X8 cm 'HVLJQ stitches:2015 Dim.:9X9 cm 'HVLJQ stitches:2246 Dim.:10X9 cm 'HVLJQ stitches: Dim.:1X1 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 180
'HVLJQ076 stitches:4979 Dim.:9X8 cm 'HVLJQ079 stitches:2198 Dim.:8X5 cm 'HVLJQ082 stitches:5284 Dim.:8X8 cm 'HVLJQ085 stitches:5939 Dim.:8X8 cm 'HVLJQ088 stitches:3593 Dim.:5X6 cm 'HVLJQ077 stitches:3955 Dim.:9X6 cm 'HVLJQ080 stitches:5424 Dim.:9X9 cm 'HVLJQ083 stitches:5569 Dim.:8X9 cm ' - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 181
'HVLJQ091 stitches:18487 Dim.:14X14 cm 'HVLJQ094 stitches:9809 Dim.:8X17 cm 'HVLJQ097 stitches:7138 Dim.:7X6 cm 'HVLJQ100 stitches:3213 Dim.:2X14 cm 'HVLJQ103 stitches:1690 Dim.:6X5 cm 'HVLJQ092 stitches:14250 Dim.:14X13 cm 'HVLJQ095 stitches:9696 Dim.:9X17 cm 'HVLJQ098 stitches:13032 Dim.: - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 182
'HVLJQ106 stitches:11877 Dim.:9X9 cm 'HVLJQ109 stitches:1118 Dim.:2X2 cm 'HVLJQ112 stitches:1914 Dim.:5X7 cm 'HVLJQ115 stitches:1486 Dim.:4X6 cm 'HVLJQ118 stitches:4635 Dim.:5X11 cm 'HVLJQ107 stitches:3046 Dim.:X3 cm 'HVLJQ110 stitches:1887 Dim.:2X8 cm 'HVLJQ113 stitches:3962 Dim.:5X4 cm ' - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 183
'HVLJQ121 stitches:9219 Dim.:13X14 cm 'HVLJQ124 stitches:10269 Dim.:9X13 cm 'HVLJQ127 stitches:14858 Dim.:9X9 cm 'HVLJQ130 stitches:6617 Dim.:9X8 cm 'HVLJQ133 stitches:3714 Dim.:10X5 cm 'HVLJQ122 stitches:35046 Dim.:13X21 cm 'HVLJQ125 stitches:19996 Dim.:7X17 cm 'HVLJQ128 stitches:3466 Dim - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 184
'HVLJQ136 stitches:7303 Dim.:8X8 cm 'HVLJQ139 stitches:3816 Dim.:7X6 cm 'HVLJQ142 stitches:7073 Dim.:9X8 cm 'HVLJQ145 stitches:6780 Dim.:7X9 cm 'HVLJQ148 stitches:8247 Dim.:6X9 cm 'HVLJQ137 stitches:6840 Dim.:10X9 cm 'HVLJQ140 stitches:9005 Dim.:9X7 cm 'HVLJQ143 stitches:43316 Dim.:14X22 cm - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 185
'HVLJQ151 stitches:9935 Dim.:7X9 cm 'HVLJQ154 stitches:8273 Dim.:6X8 cm 'HVLJQ157 stitches:8749 Dim.:9X9 cm 'HVLJQ160 stitches:11477 Dim.:7X10 cm 'HVLJQ163 stitches:8334 Dim.:12X17 cm 'HVLJQ152 stitches:7238 Dim.:9X7 cm 'HVLJQ155 stitches:11944 Dim.:8X8 cm 'HVLJQ158 stitches:5945 Dim.:6X6 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 186
'HVLJQ166 stitches:2651 Dim.:9X2 cm 'HVLJQ169 stitches:9566 Dim.:5X5 cm 'HVLJQ172 stitches:36511 Dim.:14X17 cm 'HVLJQ175 stitches:6334 Dim.:10X16 cm 'HVLJQ178 stitches:8430 Dim.:7X6 cm 'HVLJQ167 stitches:3494 Dim.:9X4 cm 'HVLJQ170 stitches:2315 Dim.:4X5 cm 'HVLJQ173 stitches:7361 Dim.:6X8 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 187
'HVLJQ181 stitches:6252 Dim.:9X6 cm 'HVLJQ184 stitches:7322 Dim.:8X8 cm 'HVLJQ187 stitches:8075 Dim.:12X9 cm 'HVLJQ190 stitches:6203 Dim.:6X4 cm 'HVLJQ193 stitches:21965 Dim.:7X14 cm 'HVLJQ182 stitches:9969 Dim.:7X8 cm 'HVLJQ185 stitches:6510 Dim.:9X7 cm 'HVLJQ188 stitches:6047 Dim.:6X6 cm - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 188
'HVLJQ196 stitches:2375 Dim.:3X3 cm 'HVLJQ199 stitches:8184 Dim.:4X13 cm 'HVLJQ197 stitches:1063 Dim.:2X2 cm 'HVLJQ200 stitches:9123 Dim.:10X7 cm 'HVLJQ198 stitches:9094 Dim.:6X14 cm 14 - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 189
Font 1 : Block 30, 15 and 7 mm Font 2 : Script 25, 15 and 7 mm Characters included : $%&d'()*ö+,-./0123456ù78h9:; - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 190
la chaîne alimentaire, CE - Authorised Representative VSM GROUP AB, SVP Worldwide Drottninggatan 2, SE-56184, Huskvarna, SWEDEN Singer est la marque exclusive de The Singer Company Limited S.à.r.l. ou de ses sociétés DI¿OLpHV 7KH6LQJHU&RPSDQ\/LPLWHG6jUORXVHVVRFLpWpVDI¿OLpHV7RXV - Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 191
- Singer SE340 LEGACY | Instruction Manual and Troubleshooting Guide - Page 192
HP35593 EFS C5
INSTRUCTION MANUAL
SE300
SE340